Comparing PfGW456L13_887 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_887 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P0AGC0 Hexose-6-phosphate:phosphate antiporter from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 10:445/449 of query aligns to 6:456/463 of P0AGC0
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
24% identity, 90% coverage: 25:426/449 of query aligns to 12:414/430 of P0AA76
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
24% identity, 90% coverage: 25:426/449 of query aligns to 1:395/409 of 6e9nA
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
22% identity, 59% coverage: 53:315/449 of query aligns to 53:324/448 of Q51955
Sites not aligning to the query:
>PfGW456L13_887 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_887
MFAFFRPAAHQAPLPEEKIDSTYRRLRWQIFAGIFIGYAGYYLLRKNFSLAMPYLIDEGY
SRGQLGLAMSAIAIAYGLSKFLMGLVSDRSNPRFFLPFGLLVSAGVMFIFGFAPWATSSV
TMMFILLFINGWAQGMGWPPSGRTMVHWWSQKERGGVVSVWNVAHNVGGGLIGPLFLIGM
GLFNDWHAAFYVPAAVALAVAVFAFVTMRDTPQSVGLPPIEQYKNDYPEGYDASHEEEFS
AKEIFVKYVLRNKMLWYIALANVFVYLLRYGVLDWAPTYLKEAKGFTVDKTSWAYFFYEW
AGIPGTLLCGWMSDKIFRGNRGLTGMVFMALVTVATLVYWLNPAGNPMVDMIALLSIGFL
IYGPVMLIGLQALELAPKKAAGTAAGFTGLFGYLGGSVAASAAMGYTVDHFGWDGGFVLL
VGACLLAMAFLAPTLRHKQIASQGREALA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory