Comparing PfGW456L13_927 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
74% identity, 92% coverage: 35:450/454 of query aligns to 1:381/384 of 5ti8B
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
63% identity, 98% coverage: 7:452/454 of query aligns to 2:449/450 of 6gwiB
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
63% identity, 98% coverage: 7:452/454 of query aligns to 1:442/443 of 7qx0B
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
65% identity, 92% coverage: 35:452/454 of query aligns to 2:421/422 of 7qx3A
7q9xAAA Probable aminotransferase
59% identity, 97% coverage: 8:446/454 of query aligns to 3:443/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
59% identity, 97% coverage: 8:446/454 of query aligns to 3:443/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
59% identity, 97% coverage: 8:446/454 of query aligns to 2:442/453 of 6s4gA
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
61% identity, 91% coverage: 35:446/454 of query aligns to 2:415/427 of 4ba5A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
57% identity, 98% coverage: 10:453/454 of query aligns to 5:452/454 of 7ypmA
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
60% identity, 91% coverage: 35:446/454 of query aligns to 1:411/423 of 4a6rA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
57% identity, 98% coverage: 10:453/454 of query aligns to 5:452/455 of 7ypnD
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
47% identity, 92% coverage: 35:452/454 of query aligns to 35:460/460 of 5kr6B
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
44% identity, 95% coverage: 18:449/454 of query aligns to 15:447/448 of 6io1B
5ghgB Transaminase w58l with smba
42% identity, 96% coverage: 18:452/454 of query aligns to 11:431/433 of 5ghgB
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
43% identity, 95% coverage: 17:448/454 of query aligns to 9:445/453 of 6g4dB
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
43% identity, 95% coverage: 17:448/454 of query aligns to 9:445/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
43% identity, 95% coverage: 17:448/454 of query aligns to 9:445/451 of 6g4eA
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 91% coverage: 35:446/454 of query aligns to 31:450/455 of 5kr5A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
45% identity, 91% coverage: 35:446/454 of query aligns to 33:452/459 of 5kquC
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 94% coverage: 20:448/454 of query aligns to 56:491/504 of Q94CE5
>PfGW456L13_927 Omega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)
MTSNNPQTREWQTLSNDHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGL
WCVAIGYGRDELADAASKQMRELPYYNLFFQTAHPPVLELAKAIADIAPEGMNHVFFTGS
GSEGNDTMLRMVRHYWAIKGQPNKKVIISRKNGYHGSTVAGASLGGMTYMHEQGDLPIPG
IVHIAQPYWFAEGGEMTPEEFGVWAANQLEEKILEVGVDNVGAFIAEPIQGAGGVIIPPE
TYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYDLKPDMMTIAKGLTSGYIPMGG
LIVRDEVVDVLNEGGDFNHGFTYSGHPVAAAVGLENIRILRDEKIVERVKSETAPYLQKR
LRELNDHPLVGEVRGVGLLGAIELVQDKATRKRFEGKGVGMICRQFCFDNGLIMRAVGDT
MIIAPPLVITPAEIDELVTKARKCLDLTLSALRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory