SitesBLAST
Comparing PfGW456L13_944 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_944 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
38% identity, 97% coverage: 11:469/472 of query aligns to 3:464/465 of 3pm9A
- active site: A149 (= A157), L159 (≠ M167)
- binding flavin-adenine dinucleotide: P69 (= P77), Q70 (≠ S78), G71 (= G79), G72 (= G80), N73 (≠ R81), T74 (= T82), G75 (= G83), L76 (= L84), G79 (≠ A87), Q80 (≠ A88), L91 (≠ F99), L133 (≠ F141), G134 (≠ A142), A135 (≠ S143), C139 (≠ S147), T140 (≠ Q148), G142 (= G150), G143 (= G151), S146 (≠ G154), T147 (= T155), A149 (= A157), G150 (= G158), E200 (= E208), G201 (= G209), I205 (≠ F213), I206 (≠ V214), E423 (= E428)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
35% identity, 95% coverage: 22:470/472 of query aligns to 21:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W41), P76 (= P77), G78 (= G79), G79 (= G80), N80 (≠ R81), T81 (= T82), G82 (= G83), M83 (≠ L84), G86 (≠ A87), S87 (≠ A88), L140 (≠ F141), A142 (≠ S143), C146 (≠ S147), H147 (≠ Q148), G150 (= G151), N151 (= N152), A153 (≠ G154), T154 (= T155), G208 (= G209), I212 (≠ F213), I213 (≠ V214), E423 (= E428), N460 (= N465)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
35% identity, 95% coverage: 22:470/472 of query aligns to 20:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R333), T337 (≠ S337), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (= W41), P75 (= P77), Q76 (≠ S78), G77 (= G79), G78 (= G80), N79 (≠ R81), T80 (= T82), G81 (= G83), M82 (≠ L84), G85 (≠ A87), S86 (≠ A88), L139 (≠ F141), G140 (≠ A142), A141 (≠ S143), C145 (≠ S147), G149 (= G151), N150 (= N152), A152 (≠ G154), T153 (= T155), G157 (= G159), G207 (= G209), I212 (≠ V214), E422 (= E428), N459 (= N465)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
35% identity, 95% coverage: 22:470/472 of query aligns to 20:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W41), P75 (= P77), G77 (= G79), G78 (= G80), N79 (≠ R81), T80 (= T82), G81 (= G83), G85 (≠ A87), S86 (≠ A88), L139 (≠ F141), G140 (≠ A142), A141 (≠ S143), C145 (≠ S147), H146 (≠ Q148), G148 (= G150), G149 (= G151), N150 (= N152), A152 (≠ G154), T153 (= T155), A155 (= A157), E206 (= E208), G207 (= G209), I211 (≠ F213), I212 (≠ V214), E422 (= E428), N459 (= N465)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R333), T337 (≠ S337), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
35% identity, 95% coverage: 22:470/472 of query aligns to 20:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W41), P75 (= P77), G77 (= G79), G78 (= G80), N79 (≠ R81), T80 (= T82), G81 (= G83), G85 (≠ A87), S86 (≠ A88), L139 (≠ F141), G140 (≠ A142), A141 (≠ S143), C145 (≠ S147), H146 (≠ Q148), G149 (= G151), N150 (= N152), A152 (≠ G154), T153 (= T155), A155 (= A157), G157 (= G159), E206 (= E208), G207 (= G209), I211 (≠ F213), I212 (≠ V214), E422 (= E428), N459 (= N465)
- binding d-malate: M82 (≠ L84), R333 (= R333), T337 (≠ S337), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
35% identity, 95% coverage: 22:470/472 of query aligns to 20:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R333), T337 (≠ S337), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), N390 (= N391), H423 (= H429)
- binding flavin-adenine dinucleotide: W39 (= W41), P75 (= P77), G77 (= G79), G78 (= G80), N79 (≠ R81), T80 (= T82), G81 (= G83), M82 (≠ L84), G85 (≠ A87), S86 (≠ A88), L139 (≠ F141), G140 (≠ A142), A141 (≠ S143), C145 (≠ S147), G149 (= G151), N150 (= N152), A152 (≠ G154), T153 (= T155), A155 (= A157), G157 (= G159), G207 (= G209), I212 (≠ V214), E422 (= E428), H423 (= H429)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E428)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
35% identity, 95% coverage: 22:470/472 of query aligns to 73:517/521 of Q8N465
- S109 (≠ T58) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V76) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G80) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V96) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M102) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V121) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P138) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ G154) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G180) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G182) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S322) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R333) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ S337) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ P345) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K347) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D365) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ Y372) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H382) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G384) to V: slight reduction in catalytic activity
- N439 (= N387) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H389) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N391) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I392) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ D401) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E428) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H429) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G430) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 93% coverage: 32:468/472 of query aligns to 51:494/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 96% coverage: 15:469/472 of query aligns to 11:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P77), G75 (= G79), S76 (≠ G80), G77 (≠ R81), T78 (= T82), G79 (= G83), L80 (= L84), A83 (= A87), C84 (≠ A88), P137 (≠ A142), G138 (≠ S143), E139 (≠ A144), A142 (≠ S147), T143 (≠ Q148), G146 (= G151), N147 (= N152), S149 (≠ G154), T150 (= T155), A152 (= A157), G153 (= G158), E203 (= E208), G204 (= G209), I209 (≠ V214), E422 (= E428), H423 (= H429)
- binding fe (iii) ion: H377 (= H382), H384 (= H389), E422 (= E428)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 89% coverage: 49:470/472 of query aligns to 40:456/459 of P9WIT1
- K354 (≠ A359) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 97% coverage: 14:470/472 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R333), W322 (vs. gap), H369 (= H382), H376 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: E32 (≠ W41), P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (vs. gap), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E428)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 97% coverage: 14:470/472 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R333), W322 (vs. gap), S336 (≠ K347), H369 (= H382), H376 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), E412 (= E428), N449 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E428)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 97% coverage: 14:470/472 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R333), W322 (vs. gap), H369 (= H382), H376 (= H389), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (vs. gap), E413 (= E428), N450 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 97% coverage: 14:470/472 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W41), P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 97% coverage: 14:470/472 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L84), R317 (= R333), W321 (vs. gap), H368 (= H382), H375 (= H389), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W321 (vs. gap), Y322 (= Y335), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H368 (= H382), H375 (= H389), E412 (= E428)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
28% identity, 97% coverage: 14:470/472 of query aligns to 5:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), H369 (= H382), E413 (= E428), N450 (= N465)
- binding deaminohydroxyvaline: R319 (= R333), H414 (= H429)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
28% identity, 97% coverage: 14:470/472 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W41), P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W323 (vs. gap), E414 (= E428), H415 (= H429), N451 (= N465)
- binding manganese (ii) ion: H370 (= H382), H377 (= H389), E414 (= E428)
- binding pyruvic acid: R319 (= R333), H370 (= H382), H377 (= H389), H415 (= H429)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
28% identity, 97% coverage: 14:470/472 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding lactic acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
28% identity, 97% coverage: 14:470/472 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R333), H369 (= H382), H376 (= H389), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), W322 (vs. gap), E413 (= E428), H414 (= H429), N450 (= N465)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E428)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
28% identity, 97% coverage: 14:470/472 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P77), G70 (= G79), T71 (≠ G80), G72 (≠ R81), T73 (= T82), G74 (= G83), G78 (≠ A87), V79 (≠ A88), L90 (≠ F99), P132 (≠ F141), G133 (≠ A142), A134 (≠ S143), G140 (= G151), M141 (≠ N152), A143 (≠ G154), T144 (= T155), A146 (= A157), S147 (≠ G158), E200 (= E208), G201 (= G209), I206 (≠ V214), Y324 (= Y335), H370 (= H382), E414 (= E428), N451 (= N465)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R333), W323 (vs. gap), H415 (= H429)
Query Sequence
>PfGW456L13_944 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_944
MNCSRVLSMTNPALIEELKTLVEPGKVLTDADSLNAYGKDWTKHFAPAPTAIVFPKTTEQ
VQAIVLWANKHKVALVPSGGRTGLSAAAVAANGEVVVSFDYMNQILDVNLTDRTAVCQPG
VVTEHLQNVAEENGLYYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTRNWVAGMKVVTG
KGDVLELNRDLIKNATGYDMRQLFIGAEGTLGFVVEATMRLDRAPKNLTAMVLGTADFDS
IMPVLHAFQSKLDLTAFEFFSDKALAKVMARGDVPAPFESDCPFYALLEFEATTEEVANH
ALETFEHCVEQGWVLDGVMSQSETQLQNLWKLREYISETISHWTPYKNDISVTVSKVPAF
LKEIDAIVGEHYPDFEIVWFGHIGDGNLHLNILKPDNLSKDEFFAKCATVNKWVFETVEK
YNGSISAEHGVGMTKRDYLTYSRSPVEIEYMKAVKAVFDPNGIMNPGKIFAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory