Comparing PfGW456L13_951 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_951 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
O53289 Phosphoserine phosphatase SerB2; PSP; PSPase; O-phosphoserine phosphohydrolase; Protein-serine/threonine phosphatase; EC 3.1.3.3; EC 3.1.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
24% identity, 94% coverage: 2:207/218 of query aligns to 180:369/409 of O53289
Sites not aligning to the query:
8a21A Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with phenylimidazole (see paper)
25% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 8a21A
Sites not aligning to the query:
8a1zA Crystal structure of phosphoserine phosphatase serb from mycobacterium avium in complex with 1-(2,4-dichlorophenyl)-3-hydroxyurea (see paper)
25% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 8a1zA
A0QJI1 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Mycobacterium avium (strain 104) (see paper)
25% identity, 94% coverage: 2:207/218 of query aligns to 182:371/411 of A0QJI1
5jlpA Crystal structure of mycobacterium avium serb2 in complex with serine at act domain
25% identity, 94% coverage: 2:207/218 of query aligns to 178:367/396 of 5jlpA
Sites not aligning to the query:
7qplA Crystal structure of phosphoserine phosphatase (serb) from brucella melitensis in complex with phosphate and magnesium
23% identity, 95% coverage: 2:209/218 of query aligns to 81:273/295 of 7qplA
1l7nA Transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) (see paper)
22% identity, 94% coverage: 2:207/218 of query aligns to 4:193/209 of 1l7nA
1f5sA Crystal structure of phosphoserine phosphatase from methanococcus jannaschii (see paper)
22% identity, 94% coverage: 2:207/218 of query aligns to 5:194/210 of 1f5sA
Q58989 Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see 3 papers)
22% identity, 94% coverage: 2:207/218 of query aligns to 6:195/211 of Q58989
>PfGW456L13_951 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_951
MRLALFDLDNTLLGGDSDHAWGDYLCERGFLDAVAYKTRNDAFYQDYLAGKLDNAAYLNF
CLEVLGRTEMATLDQWHSDYMRDCIEPIVLPKGLELLKKHRDAGDKLVIITATNRFVTGP
IAERLGVETLIATECEMVDGRYTGRSTDVPCFREGKVTRLNRWLEETGFTLEDSYFYSDS
MNDFPLLEQVTHPVAVDPDPNLRAEAEKRGWPVISLRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory