SitesBLAST
Comparing PfGW456L13_970 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 92% coverage: 23:449/463 of query aligns to 6:421/425 of O59010
- S65 (= S87) mutation to V: Strongly decreased chloride conductance.
- R276 (= R307) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 307:309) binding
- M311 (≠ Q343) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ C346) binding
- V355 (= V389) binding
- D394 (= D422) binding
- M395 (= M423) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R425) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N429) binding
- D405 (≠ S433) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 92% coverage: 23:450/463 of query aligns to 4:422/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 92% coverage: 23:450/463 of query aligns to 4:422/427 of 5e9sA
- binding aspartic acid: R274 (= R307), S275 (= S308), S276 (= S309), T313 (≠ C346), G353 (= G388), V354 (= V389), A357 (≠ G392), G358 (≠ A393), D394 (= D422), R397 (= R425), T398 (= T426)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R228), G198 (≠ L232), Y202 (≠ L236)
- binding sodium ion: Y87 (≠ L112), T90 (= T115), S91 (≠ T116), S276 (= S309), G305 (= G338), A306 (= A339), T307 (= T340), N309 (≠ G342), N309 (≠ G342), M310 (≠ Q343), D311 (≠ N344), S348 (= S383), I349 (≠ A384), G350 (= G385), T351 (≠ V386), N401 (= N429), V402 (= V430), D405 (≠ S433)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 92% coverage: 23:450/463 of query aligns to 1:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ T25), L191 (≠ R228), G195 (≠ L232), R282 (≠ E318)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R307), S272 (= S308), S273 (= S309), M307 (≠ Q343), T310 (≠ C346), G353 (= G391), A354 (≠ G392), R394 (= R425), T395 (= T426)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 92% coverage: 23:450/463 of query aligns to 2:420/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 93% coverage: 32:462/463 of query aligns to 6:416/416 of 6r7rA
- binding d-aspartic acid: R263 (= R307), S265 (= S309), M299 (≠ Q343), T302 (≠ C346), T340 (≠ V386), G342 (= G388), V343 (= V389), G347 (≠ A393), D383 (= D422), R386 (= R425), T387 (= T426), N390 (= N429)
- binding decyl-beta-d-maltopyranoside: H23 (= H48), V212 (≠ I257), A216 (≠ G261)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
31% identity, 90% coverage: 27:442/463 of query aligns to 2:406/409 of 6bavA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 91% coverage: 23:442/463 of query aligns to 6:414/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y7 (≠ H24), F46 (≠ V68), F46 (≠ V68), P75 (≠ A98), L91 (≠ F114), F95 (≠ I118), L130 (≠ V158), I133 (≠ L166), I159 (≠ A195), Y167 (≠ Q203), K196 (≠ R228), G200 (≠ L232), I207 (≠ Y239), F210 (≠ L242), L250 (= L281), I262 (≠ F293), M269 (≠ L300), T334 (≠ D368), V335 (≠ P369), G336 (≠ L370), T340 (= T374), L343 (≠ A377), M399 (≠ A427)
- binding aspartic acid: S277 (= S308), S278 (= S309), T314 (≠ C346), G354 (= G388), A358 (≠ G392), G359 (≠ A393), D394 (= D422), R397 (= R425), T398 (= T426)
- binding sodium ion: Y89 (≠ L112), T92 (= T115), S93 (≠ T116), G306 (= G338), T308 (= T340), N310 (≠ G342), N310 (≠ G342), M311 (≠ Q343), D312 (≠ N344), S349 (= S383), I350 (≠ A384), T352 (≠ V386), N401 (= N429), V402 (= V430), D405 (≠ S433)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 90% coverage: 27:442/463 of query aligns to 1:405/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 91% coverage: 23:442/463 of query aligns to 3:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ H24), G66 (≠ A91), V83 (≠ I109), I157 (≠ F196), Y164 (≠ Q203), K193 (≠ R228), T305 (= T340), I306 (= I341), I347 (≠ A384)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V33), M199 (= M234), S275 (= S309), T311 (≠ C346), G356 (≠ A393), L384 (≠ I415), D391 (= D422), R394 (= R425)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
31% identity, 90% coverage: 27:442/463 of query aligns to 2:406/408 of 6bauA
- binding cysteine: S270 (= S309), M303 (≠ Q343), T306 (≠ C346), A345 (= A387), G346 (= G388), V347 (= V389), G351 (≠ A393), D386 (= D422), C389 (≠ R425), T390 (= T426), N393 (= N429)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 90% coverage: 27:442/463 of query aligns to 2:394/396 of 6bmiA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
27% identity, 87% coverage: 61:461/463 of query aligns to 48:471/503 of Q10901
- N177 (= N162) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (= N174) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
27% identity, 87% coverage: 56:457/463 of query aligns to 44:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L101), G89 (= G102), G92 (≠ S105), A95 (≠ T108), V96 (≠ I109), Y99 (≠ L112), M163 (≠ A195), F167 (≠ V199), F293 (= F333), V297 (≠ F337)
- binding aspartic acid: S268 (= S308), S269 (= S309), T306 (≠ C346), G346 (= G388), I347 (≠ V389), A350 (≠ G392), G351 (≠ A393), D380 (= D422), R383 (= R425), T384 (= T426)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 86% coverage: 56:455/463 of query aligns to 36:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V92), S80 (≠ L101), G81 (= G102), G84 (≠ S105), Y91 (≠ L112), M156 (≠ A195), F160 (≠ V199), F286 (= F333), V290 (≠ F337)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V84), I148 (= I187), S262 (= S309), S263 (≠ A310), A292 (= A339), T293 (= T340), M296 (≠ Q343), T299 (≠ C346), G329 (= G385), A336 (≠ G392), G337 (≠ A393), D366 (= D422), R369 (= R425), N373 (= N429)
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
26% identity, 85% coverage: 59:450/463 of query aligns to 69:484/532 of P43007
- N201 (≠ D160) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ Q165) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ A224) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ M423) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 85% coverage: 59:450/463 of query aligns to 69:484/532 of O35874
- N201 (≠ D160) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ Q165) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q21353 Putative sodium-dependent excitatory amino acid transporter glt-3 from Caenorhabditis elegans (see paper)
27% identity, 85% coverage: 69:462/463 of query aligns to 43:457/532 of Q21353
- N164 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N169 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 92% coverage: 28:451/463 of query aligns to 40:515/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
24% identity, 88% coverage: 28:433/463 of query aligns to 40:485/573 of P31596
- K298 (= K247) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H278) mutation H->N,T,K,R: No transporter activity.
Query Sequence
>PfGW456L13_970 FitnessBrowser__pseudo13_GW456_L13:PfGW456L13_970
MNLPLILNLLVFLALLLGLAQTRHTTWSLAKKVLLALVLGVAFGVTLHTVYGAGNPVLKA
SIGWFDLVGNGYVQLLQMIVIPLVFASILSAVARLHNASSLGKISFLTIGTLLFTTAIAA
LIGIGLTNLFGLTAEGLVAGTQEMARLQTIQTDYAGKVADLNVPQLLLSFIPQNPFADLA
RAKPTSIISVVIFAAFLGVAALQLLKDDAEKGQKVINAIDTLQAWVMRLVRLVMKLTPYG
VLALMTKVVAGSNLQDIIKLGSFVVVSYIGLGLMFVVHGVLVSAAGINPLRFFRKIWPVL
TFAFTSRSSAATIPLSIEAQTSRLGIPQSIASFAASFGATIGQNGCAGLYPAMLAVMVAP
TVGINPLDPLWIATLVAIVTLSSAGVAGVGGGATFAALIVLPAMGLPVSLVALLISVEPL
IDMGRTALNVSGSITAGAITSQVMQQTDKELLDADEHSALAQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory