Comparing RR42_RS00190 FitnessBrowser__Cup4G11:RR42_RS00190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
1uskA L-leucine-binding protein with leucine bound (see paper)
29% identity, 83% coverage: 32:356/393 of query aligns to 1:322/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
29% identity, 83% coverage: 32:356/393 of query aligns to 1:322/345 of 1usiA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
28% identity, 82% coverage: 34:356/393 of query aligns to 3:320/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
28% identity, 82% coverage: 34:356/393 of query aligns to 3:320/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
28% identity, 82% coverage: 34:356/393 of query aligns to 3:320/344 of 1z16A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
30% identity, 87% coverage: 34:376/393 of query aligns to 3:343/345 of 4n0qB
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
26% identity, 86% coverage: 33:369/393 of query aligns to 1:334/350 of 3td9A
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
31% identity, 63% coverage: 32:277/393 of query aligns to 2:245/348 of 3ip9A
Sites not aligning to the query:
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
31% identity, 63% coverage: 32:277/393 of query aligns to 2:245/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
31% identity, 63% coverage: 32:277/393 of query aligns to 2:245/348 of 3ip6A
Sites not aligning to the query:
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
31% identity, 63% coverage: 32:277/393 of query aligns to 2:245/348 of 3ip5A
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
25% identity, 84% coverage: 32:360/393 of query aligns to 2:351/376 of 4q6wA
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
31% identity, 63% coverage: 32:277/393 of query aligns to 2:245/348 of 3ipcA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
25% identity, 87% coverage: 34:374/393 of query aligns to 3:339/348 of 4gnrA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
21% identity, 76% coverage: 76:375/393 of query aligns to 42:333/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
22% identity, 76% coverage: 76:375/393 of query aligns to 42:332/335 of 4q6bA
4eygB Crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with vanillic acid (see paper)
22% identity, 51% coverage: 31:229/393 of query aligns to 1:196/364 of 4eygB
Sites not aligning to the query:
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
22% identity, 52% coverage: 152:354/393 of query aligns to 122:333/364 of 4rv5A
Sites not aligning to the query:
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
22% identity, 52% coverage: 152:354/393 of query aligns to 122:333/364 of 4obbA
Sites not aligning to the query:
>RR42_RS00190 FitnessBrowser__Cup4G11:RR42_RS00190
MRVRKKNTVVAAALLLASAGLAGMSAPAAAKDVVKIAFVGPLTGGVSSIGLGGRNSADLA
VRLRNADPKSKYTYELVTQDDECRPNVGVQVATKIAADKSIVAGVTHFCSAVAMGTVGVY
NRFGMPAVVWGAVLPDVTYGNNFKEIHRVNGTMINQSEVAAKFMTGLGYKKWAIIHDTTD
YGKGHNKYFSEFLKKDGGTVLGTFGVTADQQDFTTELTKIRELKPDVVYFGGLTPLGVRI
RTQMEKLGIKAQFEGTSGIKSDAYIQGTGKEQAEGSLAFIEGAPWEKLPGGLFFAGKYSQ
QKYSDPPEAYGPFAFAAAKLIMDAVEKVGPDRKKVRDTLNATKDADTIIGKVTFDDHRQN
IVPLVTKYVVEDGKWVIWEDSTYGKGKKKLAGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory