Comparing RR42_RS00210 RR42_RS00210 ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
48% identity, 97% coverage: 9:241/241 of query aligns to 6:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 96% coverage: 10:241/241 of query aligns to 3:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 97% coverage: 9:241/241 of query aligns to 2:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 97% coverage: 9:241/241 of query aligns to 2:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 97% coverage: 9:241/241 of query aligns to 2:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 97% coverage: 9:241/241 of query aligns to 3:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 97% coverage: 8:240/241 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 97% coverage: 8:240/241 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 96% coverage: 8:239/241 of query aligns to 1:233/233 of 6b8bA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 10:232/241 of query aligns to 5:240/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 93% coverage: 10:232/241 of query aligns to 5:240/254 of 1g6hA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
27% identity, 93% coverage: 10:232/241 of query aligns to 5:231/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 96% coverage: 10:240/241 of query aligns to 3:235/241 of 4u00A
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
34% identity, 84% coverage: 25:227/241 of query aligns to 18:222/222 of 8i6rB
Sites not aligning to the query:
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
33% identity, 91% coverage: 10:229/241 of query aligns to 4:221/247 of P55339
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 92% coverage: 10:231/241 of query aligns to 5:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 92% coverage: 10:231/241 of query aligns to 5:230/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 92% coverage: 10:231/241 of query aligns to 3:228/253 of 6z5uK
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
29% identity, 88% coverage: 10:221/241 of query aligns to 4:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 88% coverage: 10:221/241 of query aligns to 4:218/230 of 6z4wA
>RR42_RS00210 RR42_RS00210 ABC transporter ATP-binding protein
MSTLDSPGTLSVKGLTTGYDKVNVLHDVSIDVAPGKITCILGANGAGKSTLIRAILGLTP
PRQGQVLWDGKDLAGEKTHNIIATGIACIPEGRKIFPRMTVAENLALGAYLETDAARVRD
RLAKVYDIFPRLKERATQLAGTMSGGEQAMVSIGRGLMAEPKLLVIDEPSLGLSPLYVKE
NFKVIKQINALGITVLLVEQNARQTLAISHYGYVLSQGRVVAQGTAEALASNDEVRSAYF
G
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory