Comparing RR42_RS00390 FitnessBrowser__Cup4G11:RR42_RS00390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 92% coverage: 33:420/422 of query aligns to 33:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 89% coverage: 48:421/422 of query aligns to 52:428/442 of P54968
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 88% coverage: 51:421/422 of query aligns to 13:377/380 of P54955
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
40% identity, 80% coverage: 37:373/422 of query aligns to 7:344/398 of 6slfA
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
35% identity, 91% coverage: 37:421/422 of query aligns to 4:389/389 of 4ewtA
3ramA Crystal structure of hmra (see paper)
25% identity, 62% coverage: 51:311/422 of query aligns to 21:260/391 of 3ramA
Sites not aligning to the query:
>RR42_RS00390 FitnessBrowser__Cup4G11:RR42_RS00390
MSEHAPELIESLLADSHATRPAASFASTTSRASRFCELADTVDSRAELEAIRHSIHQHPE
LAFDEVRTAELVATELEGWGYAVTRGVGGTGVVGTLCQGDGPRSIGVRADMDALPIHERT
GLAYASIHAGKMHACGHDGHTTVLLGAARQLARTRNFNGTVNLIFQPAEEIGAGGGAERM
LADGLFERFPCDAIFGLHNHPGVEAGTFMFRAGPFMAACDTVAITIRGKGGHAARPHQSI
DPILVAGSLVMALQSIVSRNIDPNETAVVTIGTLHAGHVANVIPESAKLELSVRSFSPDV
RRTLEDRIRRLVTSHVEGYGATVEIDYIRGYPVLINSERETEFARQVAEELVGPDKVVAN
FPLIAGSEDFAYFLQQRPGCFVRMGNGAGQPLLHNAGYDFNDENLTVGAAYWARLVERYL
EA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory