SitesBLAST
Comparing RR42_RS00775 FitnessBrowser__Cup4G11:RR42_RS00775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
63% identity, 99% coverage: 8:915/915 of query aligns to 337:1222/1227 of P13009
- E694 (= E371) binding
- GDVHD 756:760 (= GDVHD 440:444) binding
- D757 (= D441) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H443) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S488) binding
- T808 (= T492) binding
- S810 (= S494) mutation to A: Decreases activity by about 40%.
- A860 (= A548) binding
- D946 (= D634) binding
- R1134 (= R828) binding
- YY 1189:1190 (≠ YF 882:883) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
53% identity, 99% coverage: 11:915/915 of query aligns to 355:1260/1265 of Q99707
- GSR 382:384 (≠ GSK 38:40) binding
- D449 (= D105) binding
- N470 (= N126) binding
- D537 (= D193) binding
- N579 (= N235) binding
- R585 (= R241) binding
- R591 (= R247) binding
- D919 (≠ Q581) to G: in dbSNP:rs1805087
- D963 (≠ N623) mutation to E: Decreases binding to MTRR; when associated with N-1071.
- K1071 (≠ R724) mutation to N: Decreases binding to MTRR; when associated with E-963.
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
57% identity, 64% coverage: 332:915/915 of query aligns to 9:572/576 of 3ivaA
- active site: D107 (= D441), H109 (= H443), S160 (= S494)
- binding cobalamin: H109 (= H443), G112 (= G446), V116 (= V450), G152 (= G486), L153 (= L487), S154 (= S488), L156 (= L490), I157 (= I491), T158 (= T492), G183 (= G521), G184 (= G522), Q208 (≠ P546), N209 (≠ D547), T303 (= T641), D443 (= D787), A486 (= A830), G488 (= G832), Y489 (= Y833), H495 (= H839), A520 (= A863), M521 (= M864), G524 (≠ A867), V527 (= V870), S528 (= S871)
- binding s-adenosyl-l-homocysteine: E447 (= E791), R484 (= R828), P485 (= P829), Y489 (= Y833), A491 (= A835), Y539 (= Y882)
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
57% identity, 64% coverage: 332:915/915 of query aligns to 9:572/577 of 3bulA
- active site: D107 (= D441), H109 (= H443), S160 (= S494)
- binding cobalamin: H109 (= H443), V116 (= V450), G152 (= G486), L153 (= L487), S154 (= S488), L156 (= L490), I157 (= I491), T158 (= T492), G183 (= G521), G184 (= G522), Q208 (≠ P546), N209 (≠ D547), A210 (= A548), T213 (≠ S551), M302 (≠ Q640), D443 (= D787), A486 (= A830), P487 (= P831), G488 (= G832), Y489 (= Y833), H495 (= H839), K498 (= K842), M521 (= M864), G524 (≠ A867), V527 (= V870), S528 (= S871)
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
67% identity, 31% coverage: 27:310/915 of query aligns to 4:286/287 of 3k13C
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E9 (= E32), G15 (= G38), R17 (≠ K40), N103 (= N126), D170 (= D193), G209 (= G232), S211 (= S234), N212 (= N235), R218 (= R241), R224 (= R247), I244 (= I267)
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
60% identity, 32% coverage: 11:306/915 of query aligns to 315:610/611 of 4cczA
- binding (6s)-5,6,7,8-tetrahydrofolate: E336 (= E32), G342 (= G38), R344 (≠ K40), N430 (= N126), M458 (= M154), D497 (= D193), G536 (= G232), S538 (= S234), N539 (= N235), F542 (= F238), R545 (= R241), R551 (= R247)
6bdyA Crystal structure of the meth reactivation domain bound to sinefungin (see paper)
54% identity, 36% coverage: 588:915/915 of query aligns to 1:322/326 of 6bdyA
1mskA Methionine synthase (activation domain) (see paper)
54% identity, 36% coverage: 588:915/915 of query aligns to 1:322/327 of 1mskA
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
62% identity, 28% coverage: 332:583/915 of query aligns to 9:245/246 of 1bmtA
- active site: D107 (= D441), H109 (= H443), S160 (= S494)
- binding co-methylcobalamin: E44 (= E371), M48 (= M375), M51 (= M378), G55 (= G382), L65 (= L392), V68 (= V395), D107 (= D441), V108 (= V442), H109 (= H443), D110 (= D444), I111 (= I445), I115 (= I449), G152 (= G486), L153 (= L487), S154 (= S488), L156 (= L490), I157 (= I491), T158 (= T492), G183 (= G521), G184 (= G522), A185 (= A523), V207 (= V545), N209 (≠ D547), A210 (= A548)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
34% identity, 60% coverage: 6:558/915 of query aligns to 313:832/841 of 8g3hA
- binding cobalamin: Q328 (≠ E23), T330 (= T25), S331 (≠ L26), F675 (= F385), V685 (= V395), K693 (= K403), G720 (= G440), V722 (= V442), H723 (= H443), D724 (= D444), I725 (= I445), G726 (= G446), V730 (= V450), M767 (≠ L487), S768 (= S488), L770 (= L490), V772 (≠ T492), I795 (≠ L519), L796 (≠ I520), G797 (= G521), G798 (= G522), A799 (= A523), Y818 (= Y544), A819 (≠ V545), E820 (≠ P546), D821 (= D547)
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8
30% identity, 61% coverage: 331:885/915 of query aligns to 1:506/507 of 8sseA
- binding cobalamin: H97 (= H443), G100 (= G446), V104 (= V450), S142 (= S488), L145 (≠ I491), V146 (≠ T492), I169 (≠ L519), G171 (= G521), G172 (= G522), A173 (= A523), H405 (≠ K783), V409 (≠ D787), S451 (≠ A830), F452 (≠ P831), G453 (= G832), Y454 (= Y833), Q463 (≠ K842), L485 (≠ M864), E488 (≠ A867), A490 (≠ S869), S492 (= S871)
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
35% identity, 30% coverage: 25:303/915 of query aligns to 1:273/282 of 5vooA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E7 (= E32), R8 (= R33), G13 (= G38), S14 (= S39), K15 (= K40), D77 (= D105), N98 (= N126), D165 (= D193), G204 (= G232), N207 (= N235), F210 (= F238), R217 (= R247), I237 (= I267)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
31% identity, 20% coverage: 342:527/915 of query aligns to 12:188/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D441), I105 (≠ V442), H106 (= H443), I108 (= I445), G109 (= G446), V113 (= V450), S150 (≠ L487), S151 (= S488), L153 (= L490), M154 (≠ I491), T155 (= T492), M180 (≠ L519), G182 (= G521), G183 (= G522)
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
32% identity, 19% coverage: 353:527/915 of query aligns to 57:216/258 of 2i2xB
- active site: D134 (= D441), H136 (= H443), T187 (≠ S494)
- binding 5-hydroxybenzimidazolylcob(iii)amide: G133 (= G440), D134 (= D441), V135 (= V442), H136 (= H443), D137 (= D444), I138 (= I445), G139 (= G446), V143 (= V450), T179 (≠ G486), T181 (≠ S488), L183 (= L490), M184 (≠ I491), T185 (= T492), A208 (≠ L519), G210 (= G521), G211 (= G522), G212 (≠ A523)
Sites not aligning to the query:
Q46EH4 Methanol--corrinoid protein; Methanol:corrinoid methyltransferase 1 subunit of 27 kDa; MT1 subunit 27 kDa from Methanosarcina barkeri (strain Fusaro / DSM 804) (see paper)
32% identity, 19% coverage: 353:527/915 of query aligns to 57:216/258 of Q46EH4
- H129 (≠ A436) mutation to K: Does not affect cobalamin-binding.
- H136 (= H443) mutation H->G,K: Abolishes cobalamin-binding.
Sites not aligning to the query:
- 256:258 HKH→KKK: Does not affect cobalamin-binding.
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
36% identity, 13% coverage: 377:498/915 of query aligns to 45:152/206 of 4jgiB
- active site: D95 (= D441), H97 (= H443), A148 (≠ S494)
- binding co-methylcobalamin: L63 (≠ V395), D95 (= D441), L96 (≠ V442), H97 (= H443), D98 (= D444), I99 (= I445), G100 (= G446), F104 (≠ V450), G140 (= G486), S142 (= S488), L145 (≠ I491)
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
26% identity, 30% coverage: 27:296/915 of query aligns to 315:559/559 of 1q8jA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E320 (= E32), D390 (= D105), N411 (= N126), D473 (= D193), G505 (= G232), N508 (= N235), F511 (= F238), R516 (= R247), I536 (= I267)
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
26% identity, 30% coverage: 27:296/915 of query aligns to 315:559/560 of 3bofA
Sites not aligning to the query:
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
31% identity, 21% coverage: 332:526/915 of query aligns to 5:185/212 of 3ezxA
- active site: D100 (= D441), H102 (= H443), S155 (= S494)
- binding 5-hydroxybenzimidazolylcobamide: M47 (= M378), F54 (= F385), D100 (= D441), I101 (≠ V442), H102 (= H443), D103 (= D444), I104 (= I445), V109 (= V450), V147 (= V485), S149 (= S488), L151 (= L490), M152 (≠ I491), T153 (= T492), M178 (≠ L519), G180 (= G521), G181 (= G522)
Sites not aligning to the query:
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
36% identity, 14% coverage: 431:559/915 of query aligns to 5:125/125 of 1y80A
- active site: D15 (= D441), H17 (= H443), T68 (≠ S494)
- binding co-5-methoxybenzimidazolylcobamide: D15 (= D441), L16 (≠ V442), H17 (= H443), D18 (= D444), I19 (= I445), G20 (= G446), V24 (= V450), G60 (= G486), M61 (≠ L487), S62 (= S488), L64 (= L490), L65 (≠ I491), T66 (= T492), I91 (≠ L519), G93 (= G521), G94 (= G522), A95 (= A523), P112 (= P546), D113 (= D547), A114 (= A548)
Query Sequence
>RR42_RS00775 FitnessBrowser__Cup4G11:RR42_RS00775
MTNDTLPPRPMRLSGLEPFTIDEDTLFVNVGERTNVTGSKAFARMILNGQFDDALVVARQ
QVENGAQIIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMLDSSKWEVIEAGLKCVQ
GKPVVNSISLKEGEEQFRHHAELIRRYGAASVVMAFDEQGQADTFARKTEICKRSYDILV
NEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATAWIKQNLPYAKVSGGVSNVSFSF
RGNDAVREAIHTVFLYHAIKAGMDMGIVNAGQLGVYDQLDAELRERVEDVVLNRREDSTD
RLLEIADRYKGGGAKKEENLLWRGTPENPVPVADRLSHALVHGLTTFIVEDTEEVRQQVE
ARGGRTIEVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVAHLLPYIEEEKRLL
AEAGGDVKARGKIVIATVKGDVHDIGKNIVSVVLQCNNFEVVNMGVMVPCNEILARAKVE
GADIVGLSGLITPSLEEMAYVASEMQRDDYFRIKKIPLLIGGATTSRVHTAVKIAPHYEG
PVVYVPDASRSVSVASSLLSDDGAARYLDELKTDYERIRHQHANKKATPMVSLAKARANK
TPVDWSAYVPPKPKFIGRRIFRNYDLTELANYIDWAPFFQTWDLAGKFPDILNDEIVGES
ARRVFSDGKAMLSRLIQGRWLTANGVLALLPANAVNDDDIEIYTDETRSQVALTWHNLRQ
QSERPVIDGVMRPNRCLADFVAPKDSGIADYIGVFAVTAGIGVDKKEAQFEADHDDYSAI
MLKSLADRLAEAFAECLHERVRRDLWGYDAGEVLTNEQLIAETYRGIRPAPGYPACPEHT
VKAPMFEFLNAAEIGMGITDSLAMTPAASVSGFYLAHPESTYFSVGKIGEDQLDDMVARR
GEERSVLERALAPNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory