Comparing RR42_RS01210 FitnessBrowser__Cup4G11:RR42_RS01210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
33% identity, 87% coverage: 40:314/315 of query aligns to 63:338/344 of 7npjB
Sites not aligning to the query:
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
33% identity, 87% coverage: 40:314/315 of query aligns to 63:338/344 of 7nphC
Sites not aligning to the query:
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
33% identity, 87% coverage: 40:314/315 of query aligns to 63:338/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
33% identity, 87% coverage: 40:314/315 of query aligns to 63:338/344 of 7nnrA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
33% identity, 87% coverage: 40:314/315 of query aligns to 66:341/347 of 2i3gA
Sites not aligning to the query:
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
26% identity, 93% coverage: 22:313/315 of query aligns to 49:335/342 of 2ozpA
Sites not aligning to the query:
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
26% identity, 93% coverage: 22:313/315 of query aligns to 51:337/344 of O50146
Sites not aligning to the query:
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
26% identity, 93% coverage: 22:313/315 of query aligns to 51:337/344 of 5einA
Sites not aligning to the query:
>RR42_RS01210 FitnessBrowser__Cup4G11:RR42_RS01210
MVFKVFVDGQEGTTGLRLLDYLSGRSDVELLRIADDKRKDPAERARFLNAADVAFLCLPD
VASREAVALVTNPDTCVIDASTAFRTTDSWAYGLPELTRGQREKIRTSKRIAVPGCHASA
FLMAVRPLVEAGVMQADYPVSAFSLTGYSGGGKQMIAEFEAGGNPKLDSPRPYSLGLAHK
HLPEMRVQAGLAQAPIFNPIVGNFLKGLAVTVPVYPDRLARKVTPEQIADLYRKHYEGEQ
FVRVMPVGDEANLDGGFFDVQASNDTNRVDLFVFGSAERIVLMARLDNLGKGAAGAAVQC
MNVHVGADEATGLSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory