Comparing RR42_RS01335 FitnessBrowser__Cup4G11:RR42_RS01335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8pn7A Engineered glycolyl-coa carboxylase (g20r variant) with bound coa (see paper)
32% identity, 93% coverage: 14:494/515 of query aligns to 7:483/506 of 8pn7A
1vrgA Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
33% identity, 96% coverage: 1:493/515 of query aligns to 1:491/515 of 1vrgA
3n6rB Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
30% identity, 96% coverage: 7:499/515 of query aligns to 1:489/506 of 3n6rB
Q168G2 Propionyl-CoA carboxylase beta chain; EC 6.4.1.3 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
30% identity, 96% coverage: 7:499/515 of query aligns to 5:493/510 of Q168G2
1on3E Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
31% identity, 98% coverage: 2:505/515 of query aligns to 8:508/520 of 1on3E
3ib9A Propionyl-coa carboxylase beta subunit, d422l (see paper)
31% identity, 94% coverage: 6:490/515 of query aligns to 8:494/521 of 3ib9A
1xnyA Biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. Coelicolor (pccb) (see paper)
31% identity, 94% coverage: 6:490/515 of query aligns to 8:494/521 of 1xnyA
8sgxE Leishmania tarentolae propionyl-coa carboxylase (alpha-4-beta-6) (see paper)
31% identity, 91% coverage: 28:495/515 of query aligns to 8:467/489 of 8sgxE
7ybuP Human propionyl-coenzyme a carboxylase
31% identity, 95% coverage: 7:494/515 of query aligns to 3:484/507 of 7ybuP
1on3C Transcarboxylase 12s crystal structure: hexamer assembly and substrate binding to a multienzyme core (with methylmalonyl-coenzyme a and methylmalonic acid bound) (see paper)
30% identity, 98% coverage: 2:505/515 of query aligns to 4:498/510 of 1on3C
5iniF Structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics (see paper)
28% identity, 98% coverage: 2:505/515 of query aligns to 1:496/511 of 5iniF
3u9sF Crystal structure of p. Aeruginosa 3-methylcrotonyl-coa carboxylase (mcc) 750 kd holoenzyme, coa complex (see paper)
30% identity, 92% coverage: 21:492/515 of query aligns to 42:514/537 of 3u9sF
8f3dA 3-methylcrotonyl-coa carboxylase in filament, beta-subunit centered (see paper)
27% identity, 92% coverage: 24:495/515 of query aligns to 76:557/566 of 8f3dA
4g2rB Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor haloxyfop from mycobacterium tuberculosis (see paper)
30% identity, 56% coverage: 217:504/515 of query aligns to 153:439/441 of 4g2rB
Sites not aligning to the query:
6tzvC Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 150:408/410 of 6tzvC
Sites not aligning to the query:
6prwC Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 150:408/410 of 6prwC
Sites not aligning to the query:
6pk2C Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 150:408/410 of 6pk2C
Sites not aligning to the query:
6p7uC Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 150:408/410 of 6p7uC
Sites not aligning to the query:
6tzvA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor phenyl-cyclodiaone from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 154:424/426 of 6tzvA
Sites not aligning to the query:
6prwA Crystal structure of the carboxyltransferase subunit of acc (accd6) in complex with inhibitor quizalofop-p derivative from mycobacterium tuberculosis
30% identity, 54% coverage: 228:504/515 of query aligns to 154:424/426 of 6prwA
Sites not aligning to the query:
>RR42_RS01335 FitnessBrowser__Cup4G11:RR42_RS01335
MSWQPEIDELAYRKQLAAQLGGPDKVKRHKDAGKLTVRERIDAIADAGSFREVGALTGSG
QYDSNGRLVGLTPANLVMGRAKVDGRPVVLVGDDFTVRGGANDGAVGEKLIHAEKMAHDL
RLPMVRLVDGTGGGGSVRNIENKGYTNIPTMKVWQHVVENMSLVPVVSLALGSVAGMGAA
RVAASHYSVMVKGTAQLFNAGPPVVARIGQVLEKNELGGSQIHTRNGVVDDEVASEEEAF
ARARRFLSYLPGSVHELPPRVEPTDDPARRDEWLLSAIPRDSRSVYKVRPIVETLVDQGS
FFEMGRHWGRAIVTGLARVDGWPVAVVASDPYHYGGGWDGPTAEKFIRFVDLAEAFHLPV
INMVDIAGFQIGLEAEKAGTMRYGVRALAAVYQATTPWCSVILRRAYGVAAAGHQHMGRF
NFRYAWPSGNWGSLPIEGGLEVAYKAEIEGADDPVQKRAEIEQRVRSLTSPFRSAEAFVV
EDIIDPRDTRSLLCEFANLAAPLREPGVRKFGIRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory