Comparing RR42_RS01535 FitnessBrowser__Cup4G11:RR42_RS01535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 96% coverage: 8:214/215 of query aligns to 542:744/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 85% coverage: 10:191/215 of query aligns to 8:183/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
38% identity, 51% coverage: 20:128/215 of query aligns to 13:110/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
38% identity, 51% coverage: 20:128/215 of query aligns to 13:110/167 of 2pkpA
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
36% identity, 35% coverage: 72:146/215 of query aligns to 781:854/909 of P09339
Sites not aligning to the query:
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
41% identity, 31% coverage: 66:131/215 of query aligns to 757:826/888 of 2b3xA
Sites not aligning to the query:
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
41% identity, 31% coverage: 66:131/215 of query aligns to 758:827/889 of P21399
Sites not aligning to the query:
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 40% coverage: 46:130/215 of query aligns to 782:869/943 of A0QX20
Sites not aligning to the query:
>RR42_RS01535 FitnessBrowser__Cup4G11:RR42_RS01535
MPDYDSDLIAALGAPLPIGNLDTDQIMPKQFLRIIDKAGLDRGLFYDMRFDAQGVPRPAF
ALNQARYQGAGVLVAGPNFGCGSSREHAVWGLQQYGIRAVIAPSFGEIFYSNAINNRLLL
VMLPQAEVDALMAAVSGSAPARIEIDLAAMSVSAGALRFAFTLAERHRTMFRQGLDMIGA
TLAQSSQIAAFTRRHHQSQPWLQDVAAKTMARLSA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory