Comparing RR42_RS01575 FitnessBrowser__Cup4G11:RR42_RS01575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
61% identity, 98% coverage: 10:443/443 of query aligns to 8:439/439 of Q9A3Q9
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
52% identity, 97% coverage: 10:440/443 of query aligns to 16:445/448 of Q9I700
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
52% identity, 97% coverage: 10:440/443 of query aligns to 9:438/441 of 4b98A
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
50% identity, 97% coverage: 10:440/443 of query aligns to 3:432/435 of 4uhmA
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
49% identity, 98% coverage: 11:442/443 of query aligns to 9:440/441 of 3a8uX
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
36% identity, 95% coverage: 25:443/443 of query aligns to 22:438/444 of 3i5tA
Sites not aligning to the query:
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
36% identity, 93% coverage: 29:441/443 of query aligns to 2:416/422 of 7qx3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 93% coverage: 29:442/443 of query aligns to 33:454/459 of 5kquC
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
34% identity, 93% coverage: 29:442/443 of query aligns to 31:452/455 of 5kr5A
Q94CE5 Gamma-aminobutyrate transaminase POP2, mitochondrial; AtGABA-T; Gamma-aminobutyric acid aminotransferase 1; Protein HEXENAL RESPONSE 1; Protein POLLEN-PISTIL INCOMPATIBILITY 2; AtPOP2; EC 2.6.1.96 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
33% identity, 96% coverage: 17:440/443 of query aligns to 58:489/504 of Q94CE5
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
35% identity, 96% coverage: 17:441/443 of query aligns to 16:437/443 of 7qx0B
D6R3B6 Vanillin aminotransferase; Putative aminotransferase; pAMT; EC 2.6.1.119 from Capsicum frutescens (Cayenne pepper) (Tabasco pepper) (see paper)
31% identity, 96% coverage: 17:443/443 of query aligns to 16:448/459 of D6R3B6
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
33% identity, 96% coverage: 17:441/443 of query aligns to 17:444/450 of 6gwiB
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 93% coverage: 29:440/443 of query aligns to 35:454/460 of 5kr6B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
33% identity, 93% coverage: 29:442/443 of query aligns to 34:453/458 of 5kr3A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
33% identity, 95% coverage: 25:443/443 of query aligns to 27:448/454 of 7ypmA
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
33% identity, 100% coverage: 2:442/443 of query aligns to 4:446/448 of 6io1B
7q9xAAA Probable aminotransferase
33% identity, 96% coverage: 17:443/443 of query aligns to 17:446/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
33% identity, 96% coverage: 17:443/443 of query aligns to 17:446/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
33% identity, 96% coverage: 17:443/443 of query aligns to 16:445/453 of 6s4gA
>RR42_RS01575 FitnessBrowser__Cup4G11:RR42_RS01575
MDAAKTVIPDLDALWMPFTANRQYKAAPRLLDSASGMYYTSHDGRQILDGCAGLWCVAAG
HCRQEIADAVARQVQTLDYAPPFQMSHPLTFEAATKVAAIMPAGLDRIFFTNSGSESVDT
ALKIALAYHRARGEGQRTRVIGRERGYHGVGFGGMAVGGIGPNRKAFSANLMPGTDHLPA
TLNIAEAAYSKGQPTWGAHLADDLERILALHDPSNVAAVIVEPLAGSAGVLVPPVGYLEK
LREITSKHGILLIFDEVITAFGRLGAATAAERFNVTPDLITMAKAINNAAVPMGAVAVRR
EVHDTVVNAAAPGAIEFLHGYTYSGHPLAMAAAIATLDIYKNENLFGRAAELAPKFEAAV
HAVRGAPHVKDIRNLGMVAGIELEPRPGQPGARGYEAFLKCLERGVLVRYTGDILAFSPP
LIITEAQIEEMFDTVKTVLQELQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory