SitesBLAST
Comparing RR42_RS01585 FitnessBrowser__Cup4G11:RR42_RS01585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
58% identity, 99% coverage: 1:461/464 of query aligns to 1:458/458 of 6f34A
- binding arginine: I40 (= I38), G42 (= G40), T43 (= T41), G44 (= G42), E115 (= E112), Y116 (= Y113), A119 (= A116), F228 (= F230), A229 (= A231), I231 (= I233), V314 (= V317)
- binding cholesterol: W201 (= W203), Y202 (≠ H204)
- binding : G28 (= G26), F30 (≠ V28), D31 (= D29), M34 (≠ L32), A178 (= A180), R179 (= R181), A186 (= A188), I187 (≠ V189), A190 (= A192), L194 (= L196), Q296 (≠ E299), V299 (= V302)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
58% identity, 99% coverage: 3:461/464 of query aligns to 1:456/456 of 5oqtA
- binding alanine: I38 (= I38), G40 (= G40), T41 (= T41), G42 (= G42), F226 (= F230), A227 (= A231), I229 (= I233)
- binding : E24 (≠ V24), G26 (= G26), F28 (≠ V28), D29 (= D29), M32 (≠ L32), A176 (= A180), R177 (= R181), A184 (= A188), A188 (= A192), L192 (= L196), Q294 (≠ E299), V297 (= V302)
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
33% identity, 88% coverage: 1:406/464 of query aligns to 11:438/629 of P30825
- N226 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P76037 Putrescine importer PuuP from Escherichia coli (strain K12) (see paper)
27% identity, 97% coverage: 8:456/464 of query aligns to 8:444/461 of P76037
- Y110 (= Y113) mutation to X: The uptake activity is reduced to one-eighth of that of wild-type.
O34739 Serine/threonine exchanger SteT from Bacillus subtilis (strain 168) (see paper)
27% identity, 95% coverage: 17:458/464 of query aligns to 4:437/438 of O34739
- C94 (≠ I105) mutation to S: Retains 25% of the transport activity; when associated with S-141; S-168; S-291 and S-415.
- C141 (≠ L166) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-168; S-291 and S-415.
- C168 (≠ V193) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-291 and S-415.
- C291 (≠ Q325) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-415.
- C415 (≠ F439) mutation to S: Retains 25% of the transport activity; when associated with S-94; S-141; S-168 and S-291.
Q7YQK4 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; L-type amino acid transporter 1; LAT1; Solute carrier family 7 member 5 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
27% identity, 91% coverage: 10:429/464 of query aligns to 24:444/503 of Q7YQK4
- C88 (≠ A68) mutation to S: No significant effect on inhibition by HgCl(2). Decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-183.
- C98 (= C75) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Slightly less decreased KM and Vmax for Phe; when associated with S-183.
- C160 (≠ V150) mutation to S: No change to KM or Vmax for Phe.
- C172 (≠ A162) mutation to S: No change to KM or Vmax for Phe.
- C174 (≠ I164) mutation to S: No change to KM or Vmax for Phe.
- C183 (≠ S173) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-88. Slightly less decreased KM and Vmax for Phe; when associated with S-98.
- G219 (≠ N209) mutation to D: Decreased KM and Vmax for Trp. Increased KM and Vmax for Phe; when associated with L-234.
- W234 (≠ F222) mutation to L: Decreased KM and Vmax for Trp. Increased KM but decreased Vmax for Phe. Increased KM and Vmax for Phe; when associated with D-219.
- C331 (≠ D307) mutation to S: No significant effect on inhibition by HgCl(2). Increased KM and Vmax for Phe.
- C377 (≠ W357) mutation to S: No significant effect on inhibition by HgCl(2).
- C403 (≠ L389) mutation to S: No significant effect on inhibition by HgCl(2).
- C439 (= C424) mutation to S: Prevents insertion into the plasma membrane and possibly protein folding.
Sites not aligning to the query:
- 454 C→S: No significant effect on inhibition by HgCl(2). Slightly increased KM but slightly decreased Vmax for Phe.
- 492 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe.
P82251 b(0,+)-type amino acid transporter 1; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; Solute carrier family 7 member 9 from Homo sapiens (Human) (see 11 papers)
25% identity, 96% coverage: 7:453/464 of query aligns to 14:454/487 of P82251
- V40 (≠ I35) to M: in CSNU; uncertain significance
- IIGSG 43:47 (≠ IIGTG 38:42) binding
- I44 (= I39) to T: in CSNU; type I; dbSNP:rs121908485
- S51 (vs. gap) to F: in CSNU; uncertain significance
- P52 (vs. gap) to L: in CSNU; impairs protein stability and dimer formation; dbSNP:rs1198613438
- A70 (≠ F62) to V: in CSNU; partial loss of amino acid transport activity; dbSNP:rs769448665
- Y99 (= Y92) to H: in CSNU; uncertain significance
- G105 (= G98) to R: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908480
- W114 (= W107) to R: in CSNU; uncertain significance
- I120 (≠ E112) to L: in CSNU; uncertain significance
- T123 (≠ L115) to M: in CSNU; partial loss of amino acid transport activity; dbSNP:rs79987078
- V142 (≠ L143) to A: no effect on amino acid transport activity; dbSNP:rs12150889
- C144 (≠ A145) modified: Interchain (with C-114 in SLC3A1)
- V170 (= V176) to M: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908479
- A182 (= A188) to T: in CSNU; type III; partial loss of amino acid transport activity; dbSNP:rs79389353
- G195 (= G201) to R: in CSNU; type III; decreased amino acid transport activity; dbSNP:rs121908482
- L223 (= L227) to M: slightly decreased amino acid transport activity; dbSNP:rs1007160
- A224 (≠ V228) to V: in CSNU; non-classic type I; dbSNP:rs140873167
- N227 (vs. gap) to D: in CSNU; decreased amino acid transport activity
- W230 (vs. gap) to R: in CSNU; complete loss of amino acid transport activity; mutation to A: Abolishes amino acid transport activity.
- D233 (≠ I233) binding ; mutation to A: Complete loss of amino acid transport activity.
- W235 (≠ F235) mutation to A: Complete loss of amino acid transport activity.
- Q237 (≠ A237) mutation to A: Reduces amino acid transport activity.
- G259 (≠ S259) to R: in CSNU; type III; impairs protein stability and dimer formation; dbSNP:rs121908483
- P261 (≠ A261) to L: in CSNU; types I and III; dbSNP:rs121908486
- S286 (≠ P289) to F: in CSNU; uncertain significance; dbSNP:rs755135545
- C321 (≠ T315) mutation to S: Does not affect amino acid transport activity.
- A324 (≠ Q325) to E: in CSNU; uncertain significance
- V330 (≠ A331) to M: in CSNU; type III; dbSNP:rs201618022
- A331 (≠ M332) to V: in CSNU; non-classic type I; dbSNP:rs768466784
- R333 (= R334) to Q: in CSNU; decreased amino acid transport activity; dbSNP:rs769576205; to W: in CSNU; severe loss of amino acid transport activity; dbSNP:rs121908484
- A354 (= A355) to T: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs939028046
- S379 (≠ N380) mutation to A: Markedly reduces amino acid transport activity.
- A382 (≠ T383) to T: in CSNU; severe loss of amino acid transport activity; dbSNP:rs774878350
- W383 (≠ L384) mutation to A: Complete loss of amino acid transport activity.
- Y386 (≠ F387) mutation to A: Loss of amino acid transport activity.
- K401 (≠ P402) to E: in CSNU; uncertain significance; dbSNP:rs760264924
- L426 (= L427) to P: in CSNU; uncertain significance
Sites not aligning to the query:
- 482 P → L: in CSNU; severe loss of amino acid transport activity; no effect on localization to the apical membrane; dbSNP:rs146815072; mutation P->A,G,S,V: No effect on amino acid transport activity.; mutation P->F,I,M,W: Decreased amino acid transport activity.
8wntB Cryo em map of slc7a10 with l-alanine substrate (see paper)
27% identity, 60% coverage: 73:352/464 of query aligns to 56:330/463 of 8wntB
Sites not aligning to the query:
8wnyB Cryo em map of slc7a10-slc3a2 complex in the d-serine bound state (see paper)
27% identity, 60% coverage: 73:352/464 of query aligns to 49:323/456 of 8wnyB
Sites not aligning to the query:
8qeyA Structure of human asc1/cd98hc heteromeric amino acid transporter (see paper)
27% identity, 60% coverage: 73:352/464 of query aligns to 50:324/449 of 8qeyA
Sites not aligning to the query:
6li9B Heteromeric amino acid transporter b0,+at-rbat complex bound with arginine (see paper)
25% identity, 93% coverage: 25:457/464 of query aligns to 1:429/458 of 6li9B
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
24% identity, 94% coverage: 21:456/464 of query aligns to 1:430/433 of 6f2wA
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
27% identity, 93% coverage: 21:452/464 of query aligns to 35:464/531 of Q9QXW9
- Y130 (= Y113) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ A116) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (= F230) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
7p9uB Cryo em structure of system xc- in complex with glutamate (see paper)
27% identity, 83% coverage: 45:429/464 of query aligns to 25:396/455 of 7p9uB
Q9UPY5 Cystine/glutamate transporter; Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; xCT from Homo sapiens (Human) (see 4 papers)
27% identity, 83% coverage: 45:429/464 of query aligns to 69:440/501 of Q9UPY5
- C86 (≠ I64) mutation to S: Does not affect L-cystine transport activity; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-158; S-197; S-271; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- R135 (≠ Y113) binding ; mutation to A: Loss of L-cystine transport activity.; mutation to K: Loss of L-cystine transport activity.
- C158 (vs. gap) modified: Interchain (with C-210 in SLC3A2); mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-197; S-271; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- Q191 (≠ N183) mutation to A: Increases sensitivity to erastin-induced ferroptosis.
- C197 (≠ V189) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-271; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-271; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-271; S-327; S-414 and S-435.
- K198 (= K190) mutation to A: Loss of L-cystine transport activity. Does not affect location at the celle membrane. Does not affect expression level.
- Y244 (≠ F230) binding
- F254 (≠ S240) mutation to A: Increases resistance to erastin-induced ferroptosis. Decreases sensitivity to erastin-induced inhibition of L-cystine transport activity.
- C271 (≠ I257) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-327; S-414 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- C327 (≠ A310) mutation to A: Does not affect L-glutamate transport activity. Does not affect location at cell membrane Does not affect expression level.; mutation to L: Loss of L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.; mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-414 and S-435. Loss of inhibitio nof L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid. Decrease L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.; mutation to T: Does not affect L-glutamate transport activity. Does not affect location at cell membrane. Does not affect expression level.
- F336 (= F323) mutation to A: Decreases L-cystine transport activity about 50%. Increases sensitivity to erastin-induced ferroptosis. Significantly decreases the L-cystine transport activity.; mutation to Y: Does not affect L-cystine transport activity.
- R396 (≠ A386) mutation to A: Loss of L-cystine transport activity.; mutation to K: Loss of L-cystine transport activity.; mutation to N: Loss of L-cystine transport activity.
- C414 (≠ R401) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-327 and S-435. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
- C435 (= C424) mutation to S: Does not affect L-cystine transport activity; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Does not affect affinity for L-cystine; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Significantly increases L-glutamate affinity; when associated with S-86; S-158; S-197; S-271; S-327 and S-414. Does not affect inhibition of L-glutamate transport activity by p-chloromercuribenzoic acid and p-chloromercuribenzenesulfonic acid.
7epzB Overall structure of erastin-bound xct-4f2hc complex (see paper)
27% identity, 83% coverage: 45:429/464 of query aligns to 25:396/453 of 7epzB
Sites not aligning to the query:
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
27% identity, 93% coverage: 21:452/464 of query aligns to 36:465/535 of Q9UHI5
- I53 (= I38) binding
- Y93 (= Y76) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ A116) Important for substrate specificity; binding ; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ A145) modified: Interchain (with C-210 in SLC3A2)
- W174 (= W170) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F230) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ I233) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ H288) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs142951280
- N395 (≠ A386) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ F387) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ A393) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs758342760
- R418 (= R406) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity; dbSNP:rs146946494
- V460 (≠ L447) to E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
P15993 Aromatic amino acid transport protein AroP; Aromatic amino acid:H(+) symporter AroP; General aromatic amino acid permease; General aromatic transport system from Escherichia coli (strain K12) (see paper)
21% identity, 90% coverage: 12:429/464 of query aligns to 2:414/457 of P15993
- Y103 (= Y113) Key residue for tryptophan transport; mutation to F: Decreases tryptophan transport to less than 50% of wild-type levels and reduces the ability of tryptophan to inhibit phenylalanine transport from 95 to 62%.
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
27% identity, 90% coverage: 12:429/464 of query aligns to 26:448/507 of Q01650
- Y117 (= Y90) mutation to A: Strongly decreased leucine transport activity.
- C164 (≠ A146) modified: Interchain (with C-210 in SLC3A2)
- D223 (≠ N209) to V: in dbSNP:rs17853937
- N230 (vs. gap) to K: in dbSNP:rs1060250
- A246 (vs. gap) mutation to V: Nearly abolishes leucine transport activity.
- F252 (= F230) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ F235) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ D236) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ A237) mutation to A: Strongly decreased leucine transport activity.
- E303 (≠ I286) mutation to K: Decreased leucine transport activity.
- P375 (vs. gap) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
27% identity, 90% coverage: 35:452/464 of query aligns to 10:425/457 of 7b00A
Query Sequence
>RR42_RS01585 FitnessBrowser__Cup4G11:RR42_RS01585
MSLFRTKNIEAMLAAARDDGLKKVLGPVDLILMGIGAIIGTGIFVLTGTGALTAGPALTV
SFVIAALACGFAALCYAEFASAIPVSGSIYTYSYATLGEIVAWMIGWDLLLEYGLATSAV
SVGWSGYFQSLMAGFGIHLPAMLTAAPGAVPGVQTLFNLPAAVIMLLITWVVSYGVRESA
RLNNVMVAVKIAVVLLFIGVGVWHVKPANWHPFAPFGLDGVFNAAALVFFAFIGFDAVTS
AAEEVRNPRRDLPIGIIGSLAVCTVLYVTVAAIMTGIVPFAKFAGIDHPVSLALQYAGEN
WVAGFVDLGAILGMTTVILVMTFGQTRIIFAMSRDGLLPERLSTVHPVHATPFFATWTVG
IVFAFIAAFVPLNVLAELINIGTLSAFTLISVAVLVLRKTRPDLPRAFRCPGVPVVPLLS
VGFCLFLMAHLQALTWVAFLAWLAIGLAIYFLYARRNAVLHGGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory