Comparing RR42_RS01630 FitnessBrowser__Cup4G11:RR42_RS01630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 81% coverage: 56:304/307 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 81% coverage: 56:304/307 of query aligns to 4:253/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 81% coverage: 56:304/307 of query aligns to 2:235/240 of 6mjpA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 81% coverage: 56:303/307 of query aligns to 2:236/241 of 4u00A
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 3:224/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 3:224/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 3:224/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 3:224/371 of 3puwA
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 3:224/371 of 3puvA
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 78% coverage: 57:296/307 of query aligns to 4:225/371 of P68187
Sites not aligning to the query:
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 78% coverage: 57:296/307 of query aligns to 1:222/367 of 1q12A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 78% coverage: 56:295/307 of query aligns to 4:230/280 of 5x40A
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 78% coverage: 56:294/307 of query aligns to 2:228/253 of 6z5uK
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 78% coverage: 56:294/307 of query aligns to 4:230/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 78% coverage: 56:294/307 of query aligns to 4:230/263 of 7d08B
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 78% coverage: 59:296/307 of query aligns to 6:232/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 78% coverage: 59:296/307 of query aligns to 6:232/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 78% coverage: 59:296/307 of query aligns to 6:232/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 78% coverage: 59:296/307 of query aligns to 6:232/353 of Q97UY8
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 76% coverage: 54:286/307 of query aligns to 2:222/501 of P04983
>RR42_RS01630 FitnessBrowser__Cup4G11:RR42_RS01630
MSRGERMTQMAWQGVGRGGDGQPAWSGASAGAGATAQALGGVQMEHAQVRQAGDVILDLQ
NISLAFGGVKALTDISFDVREHEIRAIIGPNGAGKSSMLNVINGVYHPQQGRIVFRGEER
RKMHPTAAARQGIARTFQNIALFKGMTVLDNIMTGRNTRFRSGLLANALWWGPARNEEMQ
HRRKVEEVIDFLEIQAIRKTPVGRLPYGLQKRVELARALAAEPSMLLLDEPMAGMNVEEK
QDMCRFILDVNHQFGTTIVLIEHDMGVVMDISDRVVVLDYGKKIGDGTPEAVKANPDVIR
AYLGAGH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory