SitesBLAST
Comparing RR42_RS01695 FitnessBrowser__Cup4G11:RR42_RS01695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 93% coverage: 6:408/433 of query aligns to 9:419/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 93% coverage: 6:408/433 of query aligns to 11:421/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 93% coverage: 6:408/433 of query aligns to 8:418/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ H188), G195 (≠ V192), R282 (≠ E279)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S268), S272 (= S269), S273 (= S270), M307 (≠ L303), T310 (= T306), G353 (= G349), A354 (≠ S350), R394 (= R384), T395 (≠ A385)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 93% coverage: 6:408/433 of query aligns to 11:421/427 of 5e9sA
- binding aspartic acid: R274 (≠ S268), S275 (= S269), S276 (= S270), T313 (= T306), G353 (= G346), V354 (= V347), A357 (≠ S350), G358 (= G351), D394 (≠ S381), R397 (= R384), T398 (≠ A385)
- binding decyl-beta-d-maltopyranoside: L194 (≠ H188), G198 (≠ V192), Y202 (≠ V196)
- binding sodium ion: Y87 (≠ F82), T90 (≠ I85), S91 (= S86), S276 (= S270), G305 (= G298), A306 (≠ Y299), T307 (≠ S300), N309 (= N302), N309 (= N302), M310 (≠ L303), D311 (= D304), S348 (= S341), I349 (≠ K342), G350 (= G343), T351 (≠ A344), N401 (= N388), V402 (≠ I389), D405 (≠ N392)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
29% identity, 93% coverage: 8:408/433 of query aligns to 15:421/425 of O59010
- S65 (≠ T57) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S268) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 268:270) binding
- M311 (≠ L303) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T306) binding
- V355 (= V347) binding
- D394 (≠ S381) binding
- M395 (≠ E382) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R384) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N388) binding
- D405 (≠ N392) mutation to N: Strongly decreased affinity for aspartate.
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 93% coverage: 6:408/433 of query aligns to 4:410/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S268), S265 (= S270), M299 (≠ L303), T302 (= T306), T340 (≠ A344), G342 (= G346), V343 (= V347), G347 (= G351), D383 (≠ S381), R386 (= R384), T387 (≠ A385), N390 (= N388)
- binding decyl-beta-d-maltopyranoside: H23 (= H26), V212 (≠ L217), A216 (≠ L221)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 91% coverage: 8:403/433 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 92% coverage: 8:406/433 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L38), F46 (≠ L38), P75 (≠ D67), L91 (≠ V84), F95 (= F88), L130 (≠ T130), I133 (≠ F133), I159 (≠ L159), Y167 (≠ A167), K196 (≠ H188), G200 (≠ V192), I207 (≠ L199), F210 (= F202), L250 (≠ V242), I262 (= I254), M269 (≠ L261), T334 (= T326), V335 (≠ L327), G336 (≠ L328), T340 (= T332), L343 (≠ G335), M399 (≠ L386)
- binding aspartic acid: S277 (= S269), S278 (= S270), T314 (= T306), G354 (= G346), A358 (≠ S350), G359 (= G351), D394 (≠ S381), R397 (= R384), T398 (≠ A385)
- binding sodium ion: Y89 (≠ F82), T92 (≠ I85), S93 (= S86), G306 (= G298), T308 (≠ S300), N310 (= N302), N310 (= N302), M311 (≠ L303), D312 (= D304), S349 (= S341), I350 (≠ K342), T352 (≠ A344), N401 (= N388), V402 (≠ I389), D405 (≠ N392)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 91% coverage: 8:403/433 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G61), V83 (≠ L79), I157 (≠ F160), Y164 (≠ A167), K193 (≠ H188), T305 (≠ S300), I306 (≠ F301), I347 (≠ K342)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I9), M199 (≠ T194), S275 (= S270), T311 (= T306), G356 (= G351), L384 (= L374), D391 (≠ S381), R394 (= R384)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
29% identity, 91% coverage: 8:403/433 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S270), M303 (≠ L303), T306 (= T306), A345 (≠ S345), G346 (= G346), V347 (= V347), G351 (= G351), D386 (≠ S381), C389 (≠ R384), T390 (≠ A385), N393 (= N388)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
29% identity, 91% coverage: 8:403/433 of query aligns to 7:408/409 of 6bavA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 91% coverage: 8:403/433 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 91% coverage: 21:413/433 of query aligns to 33:408/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V71), G89 (= G72), G92 (= G75), A95 (= A78), V96 (≠ L79), Y99 (≠ F82), M163 (≠ L159), F167 (≠ S163), F293 (≠ L293), V297 (≠ T297)
- binding aspartic acid: S268 (= S269), S269 (= S270), T306 (= T306), G346 (= G346), I347 (≠ V347), A350 (≠ S350), G351 (= G351), D380 (≠ S381), R383 (= R384), T384 (≠ A385)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 91% coverage: 21:413/433 of query aligns to 25:394/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I62), S80 (≠ V71), G81 (= G72), G84 (= G75), Y91 (≠ F82), M156 (≠ L159), F160 (≠ S163), F286 (≠ L293), V290 (≠ T297)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I54), I148 (= I151), S262 (= S270), S263 (≠ E271), A292 (≠ Y299), T293 (≠ S300), M296 (≠ L303), T299 (= T306), G329 (= G343), A336 (≠ S350), G337 (= G351), D366 (≠ S381), R369 (= R384), N373 (= N388)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 86% coverage: 39:410/433 of query aligns to 47:422/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S269), S281 (= S270), T318 (= T306), G363 (= G351), M367 (≠ L355), V385 (≠ L374), D388 (= D377), R395 (= R384), T396 (≠ A385)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R378)
- binding cholesterol hemisuccinate: R80 (= R73), R84 (≠ K77), I95 (≠ F88), I252 (≠ T246)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 86% coverage: 39:410/433 of query aligns to 46:423/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
28% identity, 82% coverage: 39:392/433 of query aligns to 39:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T57), L58 (≠ V58), L65 (≠ M65), V339 (≠ K342), G340 (= G343), S343 (≠ G346), I344 (≠ V347)
- binding cholesterol: W188 (≠ K195), I227 (≠ V236), F250 (≠ I254), W257 (≠ L261), M379 (≠ C383), S382 (≠ L386)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S270), M300 (≠ L303), T303 (= T306), Y306 (= Y309), G348 (= G351), L349 (≠ F352), M352 (≠ L355), I366 (≠ M370), L369 (≠ I373), V370 (≠ L374), D373 (= D377), D377 (≠ S381), R380 (= R384), T381 (≠ A385), N384 (= N388)
Sites not aligning to the query:
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
26% identity, 91% coverage: 39:433/433 of query aligns to 79:501/532 of P43007
- N201 (≠ G127) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ E132) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ K184) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ E382) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 91% coverage: 39:430/433 of query aligns to 79:518/532 of O35874
- N201 (≠ G127) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ E132) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 88% coverage: 39:417/433 of query aligns to 82:511/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>RR42_RS01695 FitnessBrowser__Cup4G11:RR42_RS01695
MMRKPFYKILYVQVLFAIAVGIVLGHFWPATGVAMKPLGDGFIKLIKMIIGPIIFCTVVS
GIAGMRDMKKVGRVGGKALLYFEVISTFALLIGLLSAHLLKPGVGFNIDPATLDTKAISQ
YVTQAHGQSTVEFFMHIIPDTMVSAFANGDILQILLISLFFGSALAAMGDRSKIVFDFVE
QVSKVFFHIVHVITKVAPLGAFGAMAFTIGKYGLGSLVPLLKLIGTFYFTAIVFVVVVLG
TVARLTGFNIFRFISYIKEELLIVLGTSSSEAALPHLMEKLENLGCSKSVVGLVVPTGYS
FNLDGTNIYMTMAVLFIAQATGIELTLLQQLTVLGVAMITSKGASGVTGSGFITLAATLA
VVPDIPVAGMVLILGIDRFMSECRALTNIIGNGVATVVMSAWEHELDRVQLDRMLRRGGD
ETAELAEAGPGVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory