Comparing RR42_RS01970 FitnessBrowser__Cup4G11:RR42_RS01970 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
51% identity, 100% coverage: 1:213/214 of query aligns to 3:213/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
51% identity, 100% coverage: 1:213/214 of query aligns to 1:211/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
51% identity, 100% coverage: 1:213/214 of query aligns to 1:211/212 of O86043
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
45% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
45% identity, 99% coverage: 3:213/214 of query aligns to 5:207/212 of 2cz2A
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
46% identity, 99% coverage: 3:213/214 of query aligns to 4:206/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
45% identity, 99% coverage: 3:213/214 of query aligns to 8:210/216 of O43708
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
44% identity, 100% coverage: 1:213/214 of query aligns to 8:212/220 of 4kaeA
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
44% identity, 100% coverage: 1:213/214 of query aligns to 10:214/222 of 4kdyA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
39% identity, 100% coverage: 1:213/214 of query aligns to 6:225/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
39% identity, 100% coverage: 1:213/214 of query aligns to 4:223/228 of 3n5oA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
40% identity, 100% coverage: 1:213/214 of query aligns to 3:214/216 of 4pxoA
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
26% identity, 93% coverage: 2:200/214 of query aligns to 4:194/201 of 3m3mA
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
37% identity, 44% coverage: 1:95/214 of query aligns to 3:93/212 of 7dweA
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
29% identity, 91% coverage: 15:209/214 of query aligns to 17:204/221 of 4pnfB
Sites not aligning to the query:
4ivfF Crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
25% identity, 91% coverage: 12:205/214 of query aligns to 14:213/227 of 4ivfF
Sites not aligning to the query:
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
24% identity, 96% coverage: 1:205/214 of query aligns to 3:194/204 of 4qq7A
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
24% identity, 88% coverage: 1:188/214 of query aligns to 1:169/197 of 4hojA
Sites not aligning to the query:
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
35% identity, 44% coverage: 1:95/214 of query aligns to 3:93/216 of 7zvpA
4nhwD Crystal structure of glutathione transferase smc00097 from sinorhizobium meliloti, target efi-507275, with one glutathione bound per one protein subunit
27% identity, 95% coverage: 1:203/214 of query aligns to 10:206/217 of 4nhwD
>RR42_RS01970 FitnessBrowser__Cup4G11:RR42_RS01970
MKLYSYFRSSASYRVRIALQLKGLPYEYMPVHLLRDGGQQLLPAYRALNPDALVPTLLDD
DHVLIQSVAMVEYLDETHPEPPLLPGSALDRAYIRALALEVACEIHPLNNLRVLKYIKHT
LGVTEEAKDAWYRHWVELGFESVNTNLVRSGKAGRFCFGDTPTLADICLVPQVFNAQRFN
IDVARYPAIAKVFDACMALPAFQQAEPKAQPDAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory