Comparing RR42_RS02275 FitnessBrowser__Cup4G11:RR42_RS02275 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
32% identity, 94% coverage: 24:395/397 of query aligns to 11:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
32% identity, 94% coverage: 24:395/397 of query aligns to 11:382/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
32% identity, 90% coverage: 39:396/397 of query aligns to 38:383/384 of 1o4sB
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
30% identity, 95% coverage: 16:394/397 of query aligns to 23:394/402 of P14909
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
31% identity, 90% coverage: 39:395/397 of query aligns to 31:384/388 of 1j32A
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
33% identity, 87% coverage: 46:391/397 of query aligns to 39:392/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 87% coverage: 46:391/397 of query aligns to 49:402/410 of P58350
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
31% identity, 95% coverage: 19:395/397 of query aligns to 7:396/402 of 5wmiA
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
32% identity, 91% coverage: 36:395/397 of query aligns to 28:396/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
31% identity, 91% coverage: 36:395/397 of query aligns to 29:397/404 of 5wmlA
Sites not aligning to the query:
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
32% identity, 90% coverage: 39:397/397 of query aligns to 32:384/385 of Q56232
Sites not aligning to the query:
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
33% identity, 91% coverage: 32:391/397 of query aligns to 29:364/368 of 1v2fA
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
33% identity, 91% coverage: 32:391/397 of query aligns to 29:364/368 of 1v2eA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
31% identity, 89% coverage: 39:391/397 of query aligns to 32:378/382 of 1b5oA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
31% identity, 89% coverage: 39:391/397 of query aligns to 32:378/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
31% identity, 89% coverage: 39:391/397 of query aligns to 32:378/382 of 1bjwA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
31% identity, 89% coverage: 39:391/397 of query aligns to 32:378/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
31% identity, 89% coverage: 39:391/397 of query aligns to 32:378/382 of 1gc3A
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
29% identity, 90% coverage: 40:397/397 of query aligns to 31:370/370 of Q58097
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
27% identity, 90% coverage: 39:394/397 of query aligns to 32:389/391 of 8wkjA
>RR42_RS02275 FitnessBrowser__Cup4G11:RR42_RS02275
MSTSPSGFACAPAAARATVHHLRASRIREVANAGIGLPDVLPFWFGESDQVTPAFIRDAA
SRALAGGATFYTHNLGIAPLRSALADYVSALHGATALDNVVVTSAGVNALMLAAQLVAGP
GDRAVAVTPLWPNLVEIPKILGAEVETVSLDYGAHGWTLDLDKLLAALTPDTRLLMINSP
NNPTGWVMSRADQQAVLAHCRRHGIWIIADEVYERLYYGKGDGAIAPSFLDIASRDERVI
CVNSFSKAWLMTGWRLGWMVLPAALTDDLGKLVEYNTSCAPSFVQEAGIVAVREGEAFTR
ELVGRLRAARDHLVSALAVVPGVDVHAPEGAMYVFFRLAGASDSLALCKQLVREARLGLA
PGSAFGDEGEGFVRWCYACDPARLDEGVRRLRGFLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory