SitesBLAST
Comparing RR42_RS02315 FitnessBrowser__Cup4G11:RR42_RS02315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
51% identity, 99% coverage: 6:508/508 of query aligns to 15:513/514 of P04968
- K62 (= K53) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N80) binding
- GGGGL 188:192 (= GGGGL 183:187) binding
- S315 (≠ C310) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
51% identity, 99% coverage: 6:508/508 of query aligns to 11:493/494 of 1tdjA
- active site: K58 (= K53), A83 (= A78), E209 (≠ Q208), S213 (= S212), C215 (≠ A214), G237 (= G236), L310 (≠ A309), S311 (≠ C310)
- binding pyridoxal-5'-phosphate: F57 (= F52), K58 (= K53), N85 (= N80), G184 (= G183), G185 (= G184), G186 (= G185), G187 (= G186), G237 (= G236), E282 (= E281), S311 (≠ C310), G312 (= G311)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
39% identity, 61% coverage: 9:319/508 of query aligns to 16:318/326 of 2gn2A
- active site: K56 (= K53), A81 (= A78), Q207 (= Q208), V211 (≠ S212), G213 (≠ A214), G235 (= G236), I308 (≠ A309), S309 (≠ C310)
- binding cytidine-5'-monophosphate: R51 (≠ P48), T52 (≠ V49), G53 (≠ F50), A114 (= A111), D117 (≠ E114), Y118 (≠ R115), N312 (= N313)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
34% identity, 59% coverage: 20:318/508 of query aligns to 20:312/319 of A4F2N8
- K53 (= K53) mutation to A: Loss of enzymatic activity.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 57% coverage: 30:318/508 of query aligns to 29:316/323 of O59791
- S82 (≠ A78) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
35% identity, 57% coverage: 30:318/508 of query aligns to 24:311/318 of 1wtcA
- active site: K52 (= K53), S77 (≠ A78), E203 (≠ Q208), G207 (≠ S212), D209 (≠ A214), G231 (= G236), I302 (≠ A309), S303 (≠ C310)
- binding phosphomethylphosphonic acid adenylate ester: K47 (≠ P48), M48 (≠ V49), A109 (≠ D110), A110 (= A111), Y114 (≠ R115)
- binding magnesium ion: E203 (≠ Q208), G207 (≠ S212), D209 (≠ A214)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E281), T278 (≠ A283), S303 (≠ C310)
Sites not aligning to the query:
1v71A Crystal structure of s.Pombe serine racemase
35% identity, 57% coverage: 30:318/508 of query aligns to 24:311/318 of 1v71A
- active site: K52 (= K53), S77 (≠ A78), E203 (≠ Q208), G207 (≠ S212), D209 (≠ A214), G231 (= G236), I302 (≠ A309), S303 (≠ C310)
- binding magnesium ion: E203 (≠ Q208), G207 (≠ S212), D209 (≠ A214)
- binding pyridoxal-5'-phosphate: F51 (= F52), K52 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), G231 (= G236), E276 (= E281), T278 (≠ A283), S303 (≠ C310), G304 (= G311)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
35% identity, 57% coverage: 30:318/508 of query aligns to 25:312/319 of 2zr8A
- active site: K53 (= K53), S78 (≠ A78), E204 (≠ Q208), G208 (≠ S212), D210 (≠ A214), G232 (= G236), I303 (≠ A309), S304 (≠ C310)
- binding magnesium ion: E204 (≠ Q208), G208 (≠ S212), D210 (≠ A214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E281), T279 (≠ A283), S304 (≠ C310)
- binding serine: S78 (≠ A78), R129 (≠ A132), D231 (= D235), G232 (= G236), A233 (≠ T237), Q234 (≠ A238), T235 (≠ V239)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
35% identity, 57% coverage: 30:318/508 of query aligns to 25:312/319 of 2zpuA
- active site: K53 (= K53), S78 (≠ A78), E204 (≠ Q208), G208 (≠ S212), D210 (≠ A214), G232 (= G236), I303 (≠ A309), S304 (≠ C310)
- binding magnesium ion: E204 (≠ Q208), G208 (≠ S212), D210 (≠ A214)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F52), K53 (= K53), S77 (= S77), S78 (≠ A78), N80 (= N80), H81 (= H81), P147 (= P150), G179 (= G183), G180 (= G184), G181 (= G185), G182 (= G186), G232 (= G236), E277 (= E281), T279 (≠ A283), S304 (≠ C310)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
33% identity, 54% coverage: 14:289/508 of query aligns to 29:299/339 of Q7XSN8
- E219 (≠ Q208) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A214) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/320 of 7nbhAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), K111 (= K108), I115 (≠ V112), Y118 (≠ R115), D235 (= D235), P281 (= P282)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/322 of 7nbgAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ T237), T282 (≠ A283)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A78), G85 (≠ A82), Q86 (= Q83), I101 (= I98), K111 (= K108), I115 (≠ V112), Y118 (≠ R115)
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/323 of 7nbfAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding magnesium ion: N244 (≠ E245)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ T237), T282 (≠ A283)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ Q21), L22 (≠ E22), T23 (= T23), P24 (≠ D24), L26 (≠ T26), T27 (≠ Y27), F46 (≠ T46)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/323 of 7nbdAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F273), L278 (≠ I279)
- binding magnesium ion: N244 (≠ E245)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ T237), E280 (= E281), T282 (≠ A283)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/323 of 7nbcCCC
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding biphenyl-4-ylacetic acid: T78 (≠ A75), H79 (≠ A76), H84 (= H81), V148 (≠ I148), H149 (= H149), P150 (= P150)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ T237), T282 (≠ A283)
Sites not aligning to the query:
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 55% coverage: 15:291/508 of query aligns to 15:290/323 of 7nbcAAA
- active site: K53 (= K53), S81 (≠ A78), E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214), G236 (= G236)
- binding calcium ion: E207 (≠ Q208), A211 (≠ S212), D213 (≠ A214)
- binding magnesium ion: N244 (≠ E245)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N83 (= N80), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (= G236), V237 (≠ T237), T282 (≠ A283)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 54% coverage: 16:291/508 of query aligns to 16:283/320 of 6zspAAA
- active site: K53 (= K53), S74 (≠ A78), E200 (≠ Q208), A204 (≠ S212), D206 (≠ A214), G229 (= G236)
- binding adenosine-5'-triphosphate: S28 (≠ A28), S29 (≠ N29), I30 (≠ L30), K48 (≠ P48), T49 (≠ V49), Q79 (= Q83), Y111 (≠ R115), E266 (≠ Q274), R267 (≠ D275), K269 (≠ R277)
- binding magnesium ion: E200 (≠ Q208), A204 (≠ S212), D206 (≠ A214)
- binding malonate ion: K53 (= K53), S73 (= S77), S74 (≠ A78), N76 (= N80), H77 (= H81), R125 (≠ A132), G229 (= G236), S232 (≠ V239)
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 54% coverage: 16:291/508 of query aligns to 16:285/310 of 7nbgDDD
- active site: K53 (= K53), S76 (≠ A78), E202 (≠ Q208), A206 (≠ S212), D208 (≠ A214), G231 (= G236)
- binding calcium ion: E202 (≠ Q208), A206 (≠ S212), D208 (≠ A214)
- binding magnesium ion: N239 (≠ E245)
- binding ortho-xylene: S76 (≠ A78), Q81 (= Q83), I96 (= I98), Y113 (≠ R115)
- binding pyridoxal-5'-phosphate: F52 (= F52), K53 (= K53), N78 (= N80), G177 (= G183), G178 (= G184), G179 (= G185), G180 (= G186), M181 (≠ L187), G231 (= G236), V232 (≠ T237), E275 (= E281), T277 (≠ A283)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 54% coverage: 16:291/508 of query aligns to 17:286/322 of 3l6bA
- active site: K54 (= K53), S77 (≠ A78), E203 (≠ Q208), A207 (≠ S212), D209 (≠ A214), G232 (= G236), T278 (≠ A283)
- binding malonate ion: K54 (= K53), S76 (= S77), S77 (≠ A78), N79 (= N80), H80 (= H81), R128 (≠ A132), G232 (= G236)
- binding manganese (ii) ion: E203 (≠ Q208), A207 (≠ S212), D209 (≠ A214)
- binding pyridoxal-5'-phosphate: F53 (= F52), K54 (= K53), N79 (= N80), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), M182 (≠ L187), V233 (≠ T237), E276 (= E281), T278 (≠ A283)
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
38% identity, 54% coverage: 44:317/508 of query aligns to 41:307/308 of 1ve5A
- active site: K50 (= K53), S56 (≠ N59), S72 (≠ A78), E200 (≠ Q208), A204 (≠ S212), D206 (≠ A214), G229 (= G236), L299 (≠ A309), S300 (≠ C310)
- binding calcium ion: E200 (≠ Q208), A204 (≠ S212), D206 (≠ A214)
- binding pyridoxal-5'-phosphate: F49 (= F52), K50 (= K53), N74 (= N80), G175 (= G183), G176 (= G184), G177 (= G185), G178 (= G186), E274 (= E281), T276 (≠ A283), S300 (≠ C310), G301 (= G311)
Query Sequence
>RR42_RS02315 FitnessBrowser__Cup4G11:RR42_RS02315
MTRKPDYLRKILTAKVYDVAQETDLTYANLLSARTGNKVWFKREDTQPVFSFKLRGAYNK
MASLSPEELKRGVIAASAGNHAQGVALSAARLKCKALIAMPVTTPQVKIDAVRERGGEWV
EIVLHGDSYSDAYNHAAVLEKKHKLTFIHPFDDPEVIAGQGTIAMEILRQHPGPLHAVFV
AIGGGGLISGIASYIKAVRPEIKVIGVQTVDSDAMKRSVDAGKRVELKEVGLFSDGTAVK
LVGKETFRITRELVDEIILVDTDAICAGLKDVFQDTRSILEPAGAMAVAGLKLYAEREKL
KGQHLVAIACGANMNFDRLRFVAERAEVGEAREAVFAVSIPEERGSFKRFCEQLGTRNVT
EFNYRIADKSMAHIFVGVQIASRAENEKIAAGFRRHGFDTLDLSNDELAKQHIRYMVGGH
SPLAHDELLYRFEFPERPGALMRFLSSMSPNWNISLFHYRNQGGDTSNILVGIQVPKNEK
RAFRDFLATLGYVHWEETENPVYKLFLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory