SitesBLAST
Comparing RR42_RS02380 FitnessBrowser__Cup4G11:RR42_RS02380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
23% identity, 28% coverage: 193:566/1324 of query aligns to 49:358/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R540), T337 (= T543), K348 (= K554)
- binding flavin-adenine dinucleotide: P75 (= P219), Q76 (≠ R220), G77 (= G221), G78 (= G222), N79 (≠ G223), T80 (= T224), G81 (= G225), M82 (≠ Y226), G85 (= G229), S86 (≠ A230), L139 (≠ P292), G140 (≠ T293), A141 (≠ S294), C145 (≠ S298), G149 (= G302), N150 (= N303), A152 (= A305), T153 (≠ M306), G157 (= G310), G207 (= G408), I212 (= I413)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
23% identity, 28% coverage: 193:566/1324 of query aligns to 49:358/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P219), G77 (= G221), G78 (= G222), N79 (≠ G223), T80 (= T224), G81 (= G225), G85 (= G229), S86 (≠ A230), L139 (≠ P292), G140 (≠ T293), A141 (≠ S294), C145 (≠ S298), H146 (≠ C299), G148 (= G301), G149 (= G302), N150 (= N303), A152 (= A305), T153 (≠ M306), A155 (= A308), E206 (= E407), G207 (= G408), I211 (= I412), I212 (= I413)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R540), T337 (= T543), K348 (= K554)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
23% identity, 28% coverage: 193:566/1324 of query aligns to 49:358/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P219), G77 (= G221), G78 (= G222), N79 (≠ G223), T80 (= T224), G81 (= G225), G85 (= G229), S86 (≠ A230), L139 (≠ P292), G140 (≠ T293), A141 (≠ S294), C145 (≠ S298), H146 (≠ C299), G149 (= G302), N150 (= N303), A152 (= A305), T153 (≠ M306), A155 (= A308), G157 (= G310), E206 (= E407), G207 (= G408), I211 (= I412), I212 (= I413)
- binding d-malate: M82 (≠ Y226), R333 (= R540), T337 (= T543), K348 (= K554)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
23% identity, 28% coverage: 193:566/1324 of query aligns to 49:358/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R540), T337 (= T543), K348 (= K554)
- binding flavin-adenine dinucleotide: P75 (= P219), G77 (= G221), G78 (= G222), N79 (≠ G223), T80 (= T224), G81 (= G225), M82 (≠ Y226), G85 (= G229), S86 (≠ A230), L139 (≠ P292), G140 (≠ T293), A141 (≠ S294), C145 (≠ S298), G149 (= G302), N150 (= N303), A152 (= A305), T153 (≠ M306), A155 (= A308), G157 (= G310), G207 (= G408), I212 (= I413)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
23% identity, 28% coverage: 193:566/1324 of query aligns to 50:359/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P219), G78 (= G221), G79 (= G222), N80 (≠ G223), T81 (= T224), G82 (= G225), M83 (≠ Y226), G86 (= G229), S87 (≠ A230), L140 (≠ P292), A142 (≠ S294), C146 (≠ S298), H147 (≠ C299), G150 (= G302), N151 (= N303), A153 (= A305), T154 (≠ M306), G208 (= G408), I212 (= I412), I213 (= I413)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), Y324 (vs. gap), H370 (≠ F595)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R540), W323 (vs. gap)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R540), W323 (vs. gap), H370 (≠ F595)
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), H370 (≠ F595)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R540), W323 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), Y324 (vs. gap), H370 (≠ F595)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), H370 (≠ F595)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R540), W323 (vs. gap)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), H370 (≠ F595)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R540)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), Y324 (vs. gap), H370 (≠ F595)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ Y226), R319 (= R540), W323 (vs. gap)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:389/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A183), P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W323 (vs. gap)
- binding manganese (ii) ion: H370 (≠ F595), H377 (vs. gap)
- binding pyruvic acid: R319 (= R540), H370 (≠ F595), H377 (vs. gap)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:387/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ Y226), R317 (= R540), W321 (vs. gap), H368 (≠ F595), H375 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W321 (vs. gap), Y322 (vs. gap)
- binding manganese (ii) ion: H368 (≠ F595), H375 (vs. gap)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
23% identity, 28% coverage: 193:566/1324 of query aligns to 102:411/521 of Q8N465
- S109 (≠ E200) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ I218) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G222) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V239) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L245) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V272) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A289) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A305) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P331) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G333) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S529) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R540) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (= T543) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ A552) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K554) binding ; binding ; mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:388/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R540), H369 (≠ F595), H376 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W322 (vs. gap)
- binding manganese (ii) ion: H369 (≠ F595), H376 (vs. gap)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 33% coverage: 176:611/1324 of query aligns to 25:388/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R540), W322 (vs. gap), H369 (≠ F595), H376 (vs. gap)
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W322 (vs. gap)
- binding manganese (ii) ion: H369 (≠ F595), H376 (vs. gap)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
25% identity, 33% coverage: 176:611/1324 of query aligns to 25:388/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W322 (vs. gap)
- binding lactic acid: R318 (= R540), H369 (≠ F595), H376 (vs. gap)
- binding manganese (ii) ion: H369 (≠ F595), H376 (vs. gap)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:388/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A183), P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W322 (vs. gap)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R540), H369 (≠ F595), H376 (vs. gap)
- binding manganese (ii) ion: H369 (≠ F595), H376 (vs. gap)
Sites not aligning to the query:
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
26% identity, 33% coverage: 176:611/1324 of query aligns to 25:388/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), H369 (≠ F595)
- binding deaminohydroxyvaline: R319 (= R540)
Sites not aligning to the query:
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 30% coverage: 176:568/1324 of query aligns to 25:348/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R540), W322 (vs. gap)
- binding flavin-adenine dinucleotide: E32 (≠ A183), P68 (= P219), G70 (= G221), T71 (≠ G222), G72 (= G223), T73 (= T224), G74 (= G225), G78 (= G229), V79 (≠ A230), L90 (≠ T242), P132 (= P292), G133 (≠ T293), A134 (≠ S294), G140 (= G302), M141 (≠ N303), A143 (= A305), T144 (≠ M306), A146 (= A308), S147 (≠ G309), E200 (= E407), G201 (= G408), I206 (= I413), W322 (vs. gap)
Sites not aligning to the query:
Query Sequence
>RR42_RS02380 FitnessBrowser__Cup4G11:RR42_RS02380
MNAPLVLDAKLAAQDAPARLREIPYNYTSFSDREIVIRLLGEEAWRILAELRGERRTGRS
ARMLYEVLGDIWVVRRNPYLQDDLLENPKRRQMLVTALHHRLSEVEKRRAADRAEHAEPA
AEDRSHRVEQLVSFAKQAIEDFKQEFAHAYDLRKRTQRVLGRITQKDNIKFDGLSRVSHV
TDATDWRVEYPFVVLTPDTEEEIAGMVKGCFELGLTIIPRGGGTGYTGGAVPLTPMSAVI
NTEKLEQLGPVEQTDLPGVSHKVGTIFSGAGVVTRRVADAADKAGLVFAVDPTSIDASCI
GGNVAMNAGGKKAVLWGTALDNLAWWRMVDPEGNWLEVTRLDHNLGKIHDVAVATFELKW
SDGNRAPGEKPLRTETLAIEGRKFRKEGLGKDVTDKFLAGLPGIQKEGCDGIITSARWIL
HRMPAHVRTVCLEFFGQARDAIPSIVEIKDYLDAESRTPGGAILAGLEHLDERYLRAVGY
ATKSKRNAFPKMVLIGDIVGDDQDAVARATSEVIRMANGKSGEGFVAVSPEARKKFWLDR
SRTAAIARHTNAFKINEDVVIPLPRMGEYTDGIERINIELSIKNKLQLTDALEAFFARGN
LPLGRSDDANEIPSAELLEDRVQHALQLLREIRSRWTYLQDHLDTPLATARASLIGHGLG
LLGQAFEARLEQQPDATVFHLLQDRTIRVSWKSEVRAELRNIFNGGEFKPILDEAQKIHK
QVLRGRVFVALHMHAGDGNVHTNIPVNSDDYDMLQDAHRAVARIMALARSLDGVISGEHG
IGITKLEFLTEDEIGEFREYKQRVDPQGRFNKGKLLPGADLRNAYTPSFGLMGHESIIMQ
QSDIGAIADSVKDCLRCGKCKPVCATHVPRANLLYSPRNKILATSLLVEAFLYEEQTRRG
ISIKHWDEFSDVADHCTVCHKCVTPCPVKIDFGDVSMNMRNLLRKMGQKKFNPGTAASMF
FLNATNPQTINMTRKVMIDWGYKAQRLGNDVLKKFARKQTAHPPATVGRAPVQEQVIHFI
NKKMPGNLPKKTARALLDIEDNEIVPIIRDPKRTSPETEAVFYFPGCGSERLFSQVGLAT
QAMLWHVGVQTVLPPGYLCCGYPQRGNGQFDKAEKMVTDNRVLFHRVANTLNYLDIKTVV
VSCGTCYDQLAGYEFDKIFPGCRIIDIHEYLLEKGVKLEGVTGTRYMYHDPCHTPIKTMD
PTKLVNELMGGNEGGSKIEKNERCCGESGTLAVSRPDVSTQIRFRKEEEMTKGADKLRTD
GFVGDVKILTSCPSCLQGLSRYKEDATVTADYIVVEMAKHLLGENWMPDYVAKANSGGIE
RVLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory