Comparing RR42_RS02510 FitnessBrowser__Cup4G11:RR42_RS02510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
35% identity, 36% coverage: 5:293/808 of query aligns to 26:312/314 of P00348
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
35% identity, 36% coverage: 5:293/808 of query aligns to 3:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
35% identity, 36% coverage: 5:293/808 of query aligns to 3:289/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
35% identity, 36% coverage: 5:293/808 of query aligns to 3:289/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
35% identity, 36% coverage: 5:293/808 of query aligns to 26:312/314 of Q16836
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
31% identity, 36% coverage: 6:292/808 of query aligns to 1:278/280 of 4kuhA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
31% identity, 36% coverage: 6:292/808 of query aligns to 1:278/282 of 4kugA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
31% identity, 36% coverage: 6:292/808 of query aligns to 2:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
31% identity, 36% coverage: 6:292/808 of query aligns to 2:279/283 of 4pzdA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 36% coverage: 6:292/808 of query aligns to 5:284/286 of P9WNP7
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
33% identity, 35% coverage: 7:292/808 of query aligns to 1:277/281 of 6aa8E
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
27% identity, 39% coverage: 69:381/808 of query aligns to 375:664/719 of 6tnmA
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 39% coverage: 69:381/808 of query aligns to 375:664/729 of P21177
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
27% identity, 49% coverage: 6:403/808 of query aligns to 361:735/763 of P40939
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
29% identity, 41% coverage: 6:337/808 of query aligns to 340:668/735 of 8oqsB
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
29% identity, 41% coverage: 6:337/808 of query aligns to 316:644/711 of 7o4uA
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
29% identity, 41% coverage: 6:337/808 of query aligns to 336:664/731 of 4b3iA
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
29% identity, 41% coverage: 6:337/808 of query aligns to 333:661/727 of 8oqoA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
29% identity, 41% coverage: 6:337/808 of query aligns to 333:661/728 of 8oqlA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
29% identity, 41% coverage: 6:337/808 of query aligns to 334:662/728 of 8oqrA
Sites not aligning to the query:
>RR42_RS02510 FitnessBrowser__Cup4G11:RR42_RS02510
MSNFIVKKVAVLGAGVMGAQIAAHLVNARVPVVLFDLPAKEGPKNGISLRAIENLKKLSP
APLGINDEAGLIQAANYEDDLALLKECDVVIEAIAERMDWKHDLYKKVAPHLASHTIFAT
NTSGLSITALSDGFDADLKSRFCGVHFFNPPRYMHLVELIPTATTQPAILDRLETFLTST
LGKGVVRAKDTPNFIANRVGIFSILAVFAEAEKYGIPFDVVDDLTGSKLGRAKSATFRTA
DVVGLDTMAHVIKTMQDTLMDDPFAPVYKTPAVLKGLVDAGALGQKTGAGFYKKEGKAIK
VLDPKTGQYVDSGKKADEIVVRMLKKEPAERIKLLRESTNPQAQFLWAVFRDVFHYIGVY
LEQIAGSAADIDLAIRWGFGWNSGPFEDWQSAGWKQVAEWVKEDIEAGKGLANVALPAWV
FAGPVAENQGVHGAQGSWSPAAQAFVQRNALPVYARQVFRAALKGTAAADPRKAGRTVEE
NDAVRIWVSEGQDDVLVVSFKSKMNTIGPDVTDGLTRAIDLAQAEYKGLVVWQPTSLQLG
APGGPFSAGANLEAAMPAFMMGGAKGIEPFVKKFQDGMMRVKYSAVPVVSAASGIALGGG
CELMLHSAKRVAALETYIGLVEVGVGLVPAGGGLKEAALAAARAAQAAGSTNYLQFLTNR
FQAAAMAKVSASALDAQKMGYLQPSDTIVFNVHELLHVAQNEVRALSNAGYRAPVPGTLV
PVAGRSGIATIKASLANMRDGGFISAHDFLIASRIAEAVCGGDVEAGSLVSEEWLLALER
KAFVDLLGTGKTQERIMGMLQTGKPVRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory