Comparing RR42_RS02575 FitnessBrowser__Cup4G11:RR42_RS02575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
64% identity, 93% coverage: 22:299/299 of query aligns to 1:278/278 of 2ia4B
2vhaA Debp (see paper)
65% identity, 90% coverage: 29:298/299 of query aligns to 7:276/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
63% identity, 81% coverage: 29:271/299 of query aligns to 5:247/503 of 8ovoA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 77% coverage: 37:267/299 of query aligns to 4:225/226 of 4zv1A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 80% coverage: 30:267/299 of query aligns to 6:234/243 of 5eyfB
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 78% coverage: 37:269/299 of query aligns to 4:225/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 80% coverage: 30:269/299 of query aligns to 3:229/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
29% identity, 80% coverage: 29:268/299 of query aligns to 2:229/229 of 5t0wA
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 80% coverage: 27:265/299 of query aligns to 1:229/247 of 2yjpA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
27% identity, 70% coverage: 72:279/299 of query aligns to 85:288/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
27% identity, 70% coverage: 72:279/299 of query aligns to 84:287/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
27% identity, 70% coverage: 72:279/299 of query aligns to 84:287/287 of 6h1uA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
26% identity, 72% coverage: 29:242/299 of query aligns to 7:220/324 of 4z9nB
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
22% identity, 79% coverage: 29:263/299 of query aligns to 6:230/251 of 1xt8B
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
25% identity, 78% coverage: 37:269/299 of query aligns to 1:224/224 of 4ymxA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
25% identity, 80% coverage: 28:266/299 of query aligns to 1:229/231 of 2v25A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
29% identity, 66% coverage: 40:237/299 of query aligns to 17:203/235 of 4g4pA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
26% identity, 69% coverage: 61:267/299 of query aligns to 19:210/217 of 2pyyB
Sites not aligning to the query:
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
24% identity, 77% coverage: 37:267/299 of query aligns to 4:226/234 of 3k4uE
5l9oB Crystal structure of agrobacterium tumefaciens c58 strain pbp soca in complex with glucopine (see paper)
22% identity, 80% coverage: 35:272/299 of query aligns to 9:236/243 of 5l9oB
>RR42_RS02575 FitnessBrowser__Cup4G11:RR42_RS02575
MNVAKLASLMIAAGVLCGTAQAAEQLTGTLQKIKDTGVITLGVRESSIPFNYNLGGVRQV
GYSYDINVKIVEAIKDQLKLPNLQVKEIPITSQNRITLLQNGTIDIECGSTTNNLERQKQ
ASFTTSIFIIGTRIMVKKDGGIKDWADLKGKNVVTTAGTTSERLLRKMNDDQKLGMNIIS
TKDHGQSFLTLESGRAVAFMMDDALLFGERAKAKNPADWIVVGKPQSRESYGCMIRKDDA
QFKKLSDTVITGMMKDGSINTLYTKWFQQPVPPKGLNLDFPLSEDMKALFKTPNDKALD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory