Comparing RR42_RS02685 FitnessBrowser__Cup4G11:RR42_RS02685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
35% identity, 90% coverage: 13:214/224 of query aligns to 2:204/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
35% identity, 90% coverage: 13:214/224 of query aligns to 2:204/207 of 1h2eA
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
37% identity, 69% coverage: 15:169/224 of query aligns to 4:158/207 of 4ij6A
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
39% identity, 67% coverage: 15:163/224 of query aligns to 6:161/223 of P9WIC7
Sites not aligning to the query:
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
39% identity, 67% coverage: 15:163/224 of query aligns to 4:159/209 of 4qihA
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
39% identity, 67% coverage: 15:163/224 of query aligns to 5:160/217 of 4pzaB
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
32% identity, 75% coverage: 10:178/224 of query aligns to 1:201/250 of P62707
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
32% identity, 74% coverage: 13:178/224 of query aligns to 2:199/239 of 1e59A
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
32% identity, 67% coverage: 13:162/224 of query aligns to 2:147/196 of 6m1xC
Q9NQ88 Fructose-2,6-bisphosphatase TIGAR; TP53-induced glycolysis and apoptosis regulator; TP53-induced glycolysis regulatory phosphatase; EC 3.1.3.46 from Homo sapiens (Human) (see 4 papers)
37% identity, 53% coverage: 15:133/224 of query aligns to 6:125/270 of Q9NQ88
Sites not aligning to the query:
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
32% identity, 67% coverage: 13:162/224 of query aligns to 2:147/198 of 5zr2C
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 76% coverage: 15:185/224 of query aligns to 10:187/211 of P36623
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
36% identity, 53% coverage: 15:133/224 of query aligns to 6:125/257 of Q7ZVE3
3gp3A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 2-phosphoserine (see paper)
40% identity, 43% coverage: 15:110/224 of query aligns to 4:104/229 of 3gp3A
Sites not aligning to the query:
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
40% identity, 43% coverage: 15:110/224 of query aligns to 4:104/230 of 3fdzA
Sites not aligning to the query:
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
40% identity, 43% coverage: 15:110/224 of query aligns to 4:104/248 of 3gp5A
Sites not aligning to the query:
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
40% identity, 43% coverage: 15:110/224 of query aligns to 4:104/249 of Q3JWH7
Sites not aligning to the query:
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
38% identity, 45% coverage: 15:114/224 of query aligns to 4:108/247 of P00950
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
38% identity, 45% coverage: 15:114/224 of query aligns to 3:107/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
38% identity, 45% coverage: 15:114/224 of query aligns to 3:107/234 of 1bq4A
Sites not aligning to the query:
>RR42_RS02685 FitnessBrowser__Cup4G11:RR42_RS02685
MSQLPGPHSLAFTHLILIRHGETAWNRERRLQGQLDIPLNATGVAQADALAQALAVEPID
AVYASDLSRAMRTAAPLAEALGLAVRPDPRLRERCYGSLEGMTYAEVAEQLPEDFARWQA
RVPDYAPDGGESLLAFHERAVQAALALGRRHPGERIALVAHGGVLDCLYREANDMTLEAP
RRHELLNASINRLRCDSVRLTVMQWADVGHLEALTLDEVDRRVP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory