Comparing RR42_RS03285 FitnessBrowser__Cup4G11:RR42_RS03285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7ndrD Crystal structure of tphc in an open conformation (see paper)
26% identity, 79% coverage: 62:312/318 of query aligns to 46:289/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
26% identity, 79% coverage: 62:312/318 of query aligns to 46:289/294 of 7ndsA
Sites not aligning to the query:
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
29% identity, 51% coverage: 78:240/318 of query aligns to 56:216/302 of 8hkbA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
25% identity, 73% coverage: 24:255/318 of query aligns to 9:235/300 of 2dvzA
>RR42_RS03285 FitnessBrowser__Cup4G11:RR42_RS03285
MRFACAALALAAACARPAAAAPECIVPAKPGGGFDLTCKLAQRALLEAGFTEQPVRLAYM
PGGIGAVAYNSIVAQRPAEPDTIVAFSDGSLLALAQGKFGKYGAADVRWVGALGTDYGVI
AVRADSPFKTLKDLVAALRSDPDQVLFGAGGTIGNQDWMKAAMVARQAGVGYKRMRFVGF
EGGGEAFTALQGGHVQAVSGDASEAAMQLGAGGIRILAVLAAQRLPGRLAGVPTAREQGF
DIVWPILRGFYMGPKVAQADYQRWAERFERLQASPAFARLRAEQGLFPADLGGADLDTYV
QRTVQRYRTLAKEFGLTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory