Comparing RR42_RS03360 FitnessBrowser__Cup4G11:RR42_RS03360 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 94% coverage: 10:512/537 of query aligns to 4:493/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 41% coverage: 9:226/537 of query aligns to 1:215/241 of 4u00A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 41% coverage: 9:226/537 of query aligns to 3:222/648 of P75831
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 40% coverage: 10:226/537 of query aligns to 1:215/240 of 4ymuJ
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 50% coverage: 10:275/537 of query aligns to 4:248/285 of 4yerA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 40% coverage: 10:226/537 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 40% coverage: 10:226/537 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 40% coverage: 10:226/537 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 40% coverage: 10:226/537 of query aligns to 3:216/242 of 2oljA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 41% coverage: 5:223/537 of query aligns to 12:224/378 of P69874
Sites not aligning to the query:
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
29% identity, 43% coverage: 7:239/537 of query aligns to 1:233/650 of 5ws4A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
29% identity, 40% coverage: 23:237/537 of query aligns to 20:232/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
29% identity, 40% coverage: 23:237/537 of query aligns to 20:232/592 of 5lj7A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 40% coverage: 11:226/537 of query aligns to 4:220/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 40% coverage: 11:226/537 of query aligns to 4:220/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 40% coverage: 11:226/537 of query aligns to 4:220/353 of 1oxuA
8hprD Lpqy-sugabc in state 4 (see paper)
28% identity, 46% coverage: 11:255/537 of query aligns to 3:245/362 of 8hprD
8hprC Lpqy-sugabc in state 4 (see paper)
28% identity, 46% coverage: 11:255/537 of query aligns to 3:245/363 of 8hprC
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 45% coverage: 2:245/537 of query aligns to 8:246/265 of P07821
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 40% coverage: 11:223/537 of query aligns to 4:210/369 of P19566
Sites not aligning to the query:
>RR42_RS03360 FitnessBrowser__Cup4G11:RR42_RS03360
MSDTSTKAPLLALRNICKTFPGVRALRKVELTAYAGEVHALMGENGAGKSTLMKILSGAY
TADPGGECHIDGQRVQIDGPQSARDLGVAVIYQELSLAPNLSVAENIYLGRALQRRGLVA
RGDMVRACAPTLARLGADFSPAANVASLSIAQRQLVEIARAVHFEARILVMDEPTTPLST
HETDRLFALIRQLRGEGMAILYISHRMAEIDELADRVTVLRDGCFVGTLDRAHLSQAALV
KMMVGRDLSGFYTKTHGQAVEREVMLSVRDVADGRRVKGCSFDLRAGEVLGLAGLVGAGR
TELARLVFGADARTRGEVRIANPAGSGGLVTLPAGGPRQAIDAGIAYLTEDRKLQGLFLD
QSVHENINLIVAARDALGLGRLNRTAARRRTTEAIDTLGIRVAHAQVNVGALSGGNQQKV
MLSRLLEIQPRVLILDEPTRGVDIGAKSEIYRLINALAQSGVAILMISSELPEVVGLCDR
VLVMREGTLAGEVRPAGSAAETQERIIALATGAAAAAPAWVDVPLPGAGNATGITLH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory