Comparing RR42_RS03385 FitnessBrowser__Cup4G11:RR42_RS03385 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 91% coverage: 11:290/309 of query aligns to 9:282/319 of Q8ZKR2
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
34% identity, 91% coverage: 13:293/309 of query aligns to 12:307/312 of 4wjmA
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
33% identity, 91% coverage: 11:290/309 of query aligns to 5:271/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
33% identity, 91% coverage: 11:290/309 of query aligns to 5:271/297 of 1tz6A
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 91% coverage: 13:292/309 of query aligns to 8:293/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
28% identity, 91% coverage: 13:292/309 of query aligns to 12:297/310 of 5yggA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 91% coverage: 12:292/309 of query aligns to 6:286/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 91% coverage: 12:292/309 of query aligns to 5:285/302 of 3gbuA
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
33% identity, 95% coverage: 10:304/309 of query aligns to 6:319/322 of 3lkiB
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
32% identity, 74% coverage: 32:261/309 of query aligns to 33:260/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 74% coverage: 32:261/309 of query aligns to 33:260/309 of Q53W83
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
32% identity, 74% coverage: 32:261/309 of query aligns to 33:260/300 of 1v1bA
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
33% identity, 91% coverage: 10:290/309 of query aligns to 5:282/282 of 7fcaD
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 90% coverage: 24:302/309 of query aligns to 28:298/300 of 8cqxA
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 81% coverage: 44:294/309 of query aligns to 47:295/308 of 3iq0B
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
27% identity, 80% coverage: 44:289/309 of query aligns to 50:279/302 of 7ag6A
Sites not aligning to the query:
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
27% identity, 80% coverage: 44:289/309 of query aligns to 50:279/298 of 7agkA
Sites not aligning to the query:
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
27% identity, 80% coverage: 44:289/309 of query aligns to 50:279/298 of P32143
Sites not aligning to the query:
2fv7A Crystal structure of human ribokinase
25% identity, 92% coverage: 8:292/309 of query aligns to 3:295/308 of 2fv7A
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
27% identity, 80% coverage: 44:289/309 of query aligns to 50:277/295 of 7aghA
>RR42_RS03385 FitnessBrowser__Cup4G11:RR42_RS03385
MTTTSWPAYVVFGEALTDMVHQGGQDWLGLPGGSCWNVARVGARLGVPTAFAGAISADTL
GDQLAEASAEAGLDLRFLQRVERSPLLAFVGAQHPPQYFFVGDDSADLYFDPERLPPGWR
QAARTVHFGSLSLARQPLAARLCTEATQARAAGKRIAFDPNFRTPMRAPEYQAVFAHMAG
LADYIKVSDEDLRGLYPALDEHAALAALRALAPQARVLLTRGADGMTLLHGDGACEQPVF
AVDVVDTVGCGDAAMGGWMAGLLLDPEATLARQARWAAATAAVAATRAGAYSPTVAEVSV
LLGEAAVLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory