Comparing RR42_RS03715 FitnessBrowser__Cup4G11:RR42_RS03715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
46% identity, 95% coverage: 6:254/263 of query aligns to 1:253/260 of 5eq9B
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
46% identity, 94% coverage: 7:254/263 of query aligns to 1:252/259 of 5eq8A
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
45% identity, 95% coverage: 6:254/263 of query aligns to 3:250/257 of 5t3jA
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 98% coverage: 3:259/263 of query aligns to 78:343/346 of Q6NPM8
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
33% identity, 82% coverage: 46:260/263 of query aligns to 41:263/266 of Q9K4B1
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 94% coverage: 12:257/263 of query aligns to 5:255/267 of P0ADG4
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
33% identity, 94% coverage: 12:257/263 of query aligns to 9:259/270 of 6ib8B
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
32% identity, 94% coverage: 12:257/263 of query aligns to 5:255/262 of 2qflA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 82% coverage: 46:261/263 of query aligns to 39:259/260 of P95189
6tqoT Rrn anti-termination complex (see paper)
34% identity, 81% coverage: 45:257/263 of query aligns to 30:247/255 of 6tqoT
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
33% identity, 82% coverage: 46:260/263 of query aligns to 36:255/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
33% identity, 82% coverage: 46:260/263 of query aligns to 37:256/256 of 5zonA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 85% coverage: 30:253/263 of query aligns to 29:260/271 of Q9M8S8
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
29% identity, 89% coverage: 2:234/263 of query aligns to 5:250/285 of Q19420
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
30% identity, 86% coverage: 10:235/263 of query aligns to 5:239/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
30% identity, 86% coverage: 10:235/263 of query aligns to 7:241/277 of P20456
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
29% identity, 86% coverage: 10:235/263 of query aligns to 3:237/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
29% identity, 86% coverage: 10:235/263 of query aligns to 3:237/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
29% identity, 86% coverage: 10:235/263 of query aligns to 3:237/272 of 1awbA
6zk0AAA human impase with ebselen (see paper)
29% identity, 86% coverage: 10:235/263 of query aligns to 4:238/274 of 6zk0AAA
>RR42_RS03715 FitnessBrowser__Cup4G11:RR42_RS03715
MPLTAEQLIEYMDFAAGLAQAAGNASLPYFRSAPAVEDKGGRHFDPVTAADKAAERAMRD
LILAKYPEHGILGEEEDRVAGTSPLTWVLDPIDGTRAFITGLPLWGTLIALNDGQRPVIG
IMDQPFTRERFSGDGSRAWLNGQPLRTRPCADLAQAKLMCTTPEMFEDAAQFAAFRRVAD
AARMQRYGGDCYAYCMVAAGHVDAVVEAGLKAYDVQALIPIVQGAGGVMTSWTGGDAQQG
GTVVACGDPRLHQQIIALLNAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory