Comparing RR42_RS03805 FitnessBrowser__Cup4G11:RR42_RS03805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
44% identity, 73% coverage: 73:300/313 of query aligns to 62:285/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
44% identity, 73% coverage: 73:300/313 of query aligns to 60:283/285 of 3uf6A
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
27% identity, 75% coverage: 48:283/313 of query aligns to 46:306/325 of 1xcoD
6zngF Maeb full-length acetyl-coa bound state (see paper)
24% identity, 81% coverage: 48:302/313 of query aligns to 465:744/753 of 6zngF
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
29% identity, 70% coverage: 86:304/313 of query aligns to 107:330/332 of 2af3C
Sites not aligning to the query:
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
29% identity, 70% coverage: 86:304/313 of query aligns to 108:331/333 of P38503
Sites not aligning to the query:
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 51% coverage: 125:283/313 of query aligns to 536:691/714 of Q8ZND6
Sites not aligning to the query:
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
28% identity, 64% coverage: 90:288/313 of query aligns to 118:321/339 of 6ioxA
>RR42_RS03805 FitnessBrowser__Cup4G11:RR42_RS03805
MTHTPDKYSVLLARCQDLPAIPTAVAHPCDASSLGGALQAASLGLIVPLLIGPEARIRQV
ADANALDLGDSVLIDVPHSHAAAARAVAAVRAGEAELLMKGSLHTDELLHEVTASTTGLR
TGRRLSHVFAMDVPSYHKPLFITDAAVNIFPTLNDKADICRNAIDLLRVLGIERPKVAIL
SAVETVTDKIPSTIDAAALCMMSRRGQIEGGILDGPLAFDNAISHEAAVTKGIVSEVAGD
PDILLVPDLEAGNMLAKQLTFLAGAEAAGIVLGARVPIIVTSRADSVRARIGSCAIAVLL
AHARRTGQASSKV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory