SitesBLAST
Comparing RR42_RS03990 FitnessBrowser__Cup4G11:RR42_RS03990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
34% identity, 92% coverage: 10:408/436 of query aligns to 16:419/425 of O59010
- S65 (≠ T63) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A271) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 271:273) binding
- M311 (≠ L306) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S309) binding
- V355 (= V350) binding
- D394 (= D383) binding
- M395 (= M384) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R386) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N390) binding
- D405 (≠ N394) mutation to N: Strongly decreased affinity for aspartate.
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
34% identity, 91% coverage: 10:406/436 of query aligns to 8:409/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
34% identity, 91% coverage: 10:405/436 of query aligns to 7:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
33% identity, 92% coverage: 10:408/436 of query aligns to 16:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L44), F46 (≠ L44), P75 (≠ D73), L91 (≠ A90), F95 (≠ T94), L130 (= L132), I133 (≠ F135), I159 (≠ L161), Y167 (≠ T169), K196 (= K191), G200 (≠ Y195), I207 (≠ V202), F210 (= F205), L250 (= L249), I262 (≠ L257), M269 (≠ L264), T334 (≠ S329), V335 (≠ L330), G336 (≠ S331), T340 (= T335), L343 (= L338), M399 (≠ V388)
- binding aspartic acid: S277 (= S272), S278 (= S273), T314 (≠ S309), G354 (= G349), A358 (= A353), G359 (≠ S354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding sodium ion: Y89 (≠ F88), T92 (≠ A91), S93 (= S92), G306 (= G301), T308 (≠ S303), N310 (= N305), N310 (= N305), M311 (≠ L306), D312 (= D307), S349 (= S344), I350 (≠ K345), T352 (≠ I347), N401 (= N390), V402 (= V391), D405 (≠ N394)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
33% identity, 91% coverage: 10:405/436 of query aligns to 8:408/408 of 6bauA
- binding cysteine: S270 (= S273), M303 (≠ L306), T306 (≠ S309), A345 (= A348), G346 (= G349), V347 (= V350), G351 (≠ S354), D386 (= D383), C389 (≠ R386), T390 (= T387), N393 (= N390)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
33% identity, 91% coverage: 10:405/436 of query aligns to 13:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G67), V83 (≠ M85), I157 (≠ F162), Y164 (≠ T169), K193 (= K191), T305 (≠ S303), I306 (≠ F304), I347 (≠ K345)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I10), M199 (= M197), S275 (= S273), T311 (≠ S309), G356 (≠ S354), L384 (= L376), D391 (= D383), R394 (= R386)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 8:396/396 of 6bmiA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 11:413/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K191), G195 (≠ Y195), R282 (≠ K279)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A271), S272 (= S272), S273 (= S273), M307 (≠ L306), T310 (≠ S309), G353 (≠ R352), A354 (= A353), R394 (= R386), T395 (= T387)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 12:414/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 14:416/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 14:416/427 of 5e9sA
- binding aspartic acid: R274 (≠ A271), S275 (= S272), S276 (= S273), T313 (≠ S309), G353 (= G349), V354 (= V350), A357 (= A353), G358 (≠ S354), D394 (= D383), R397 (= R386), T398 (= T387)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K191), G198 (≠ Y195), Y202 (≠ F199)
- binding sodium ion: Y87 (≠ F88), T90 (≠ A91), S91 (= S92), S276 (= S273), G305 (= G301), A306 (≠ Y302), T307 (≠ S303), N309 (= N305), N309 (= N305), M310 (≠ L306), D311 (= D307), S348 (= S344), I349 (≠ K345), G350 (= G346), T351 (≠ I347), N401 (= N390), V402 (= V391), D405 (≠ N394)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 91% coverage: 10:405/436 of query aligns to 7:405/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A271), S265 (= S273), M299 (≠ L306), T302 (≠ S309), T340 (≠ I347), G342 (= G349), V343 (= V350), G347 (≠ S354), D383 (= D383), R386 (= R386), T387 (= T387), N390 (= N390)
- binding decyl-beta-d-maltopyranoside: H23 (= H26), V212 (≠ L220), A216 (= A224)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
33% identity, 88% coverage: 17:401/436 of query aligns to 33:398/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V77), G89 (= G78), G92 (= G81), A95 (= A84), V96 (≠ M85), Y99 (≠ F88), M163 (≠ L161), F167 (= F165), F293 (= F296), V297 (≠ L300)
- binding aspartic acid: S268 (= S272), S269 (= S273), T306 (≠ S309), G346 (= G349), I347 (≠ V350), A350 (= A353), G351 (≠ S354), D380 (= D383), R383 (= R386), T384 (= T387)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
33% identity, 88% coverage: 17:401/436 of query aligns to 25:384/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I68), S80 (≠ V77), G81 (= G78), G84 (= G81), Y91 (≠ F88), M156 (≠ L161), F160 (= F165), F286 (= F296), V290 (≠ L300)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V60), I148 (= I153), S262 (= S273), S263 (≠ E274), A292 (≠ Y302), T293 (≠ S303), M296 (≠ L306), T299 (≠ S309), G329 (= G346), A336 (= A353), G337 (≠ S354), D366 (= D383), R369 (= R386), N373 (= N390)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
27% identity, 90% coverage: 9:401/436 of query aligns to 53:494/543 of P56564
- N206 (= N151) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
27% identity, 90% coverage: 9:401/436 of query aligns to 53:494/542 of P43003
- S363 (≠ A271) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 271:273) binding
- T396 (≠ S303) binding
- T402 (≠ S309) binding
- IPQAG 443:447 (≠ VPRAS 350:354) binding
- D476 (= D383) binding
- R477 (≠ M384) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N390) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
27% identity, 90% coverage: 13:403/436 of query aligns to 14:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F88), T88 (≠ A91), T89 (≠ S92), G319 (= G301), A320 (≠ Y302), N323 (= N305), N323 (= N305), M324 (≠ L306), D325 (= D307), N408 (= N390), D412 (≠ N394)
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 83% coverage: 46:405/436 of query aligns to 48:417/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S272), S281 (= S273), T318 (≠ S309), G363 (≠ S354), M367 (≠ V358), V385 (≠ L376), D388 (= D379), R395 (= R386), T396 (= T387)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ H380)
- binding cholesterol hemisuccinate: R80 (= R79), R84 (≠ K83), I95 (≠ T94), I252 (= I242)
Sites not aligning to the query:
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
27% identity, 90% coverage: 13:403/436 of query aligns to 14:403/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
27% identity, 90% coverage: 13:403/436 of query aligns to 11:400/406 of 8ctcA
- binding glutamic acid: S268 (= S272), S269 (= S273), M303 (≠ L306), T306 (≠ S309), G346 (= G349), A350 (= A353), D380 (= D383), R383 (= R386)
- binding sodium ion: Y82 (≠ F88), T85 (≠ A91), T86 (≠ S92), S269 (= S273), G298 (= G301), A299 (≠ Y302), T300 (≠ S303), N302 (= N305), N302 (= N305), M303 (≠ L306), D304 (= D307), S341 (= S344), I342 (≠ K345), G343 (= G346), A344 (≠ I347), N387 (= N390), D391 (≠ N394)
Query Sequence
>RR42_RS03990 FitnessBrowser__Cup4G11:RR42_RS03990
MKLNRLPTLIFIAMLLGVLAGTAAHHYAPDPAAAKSIADHLSILTDVFLRMIKMIIGPLV
FATLVSGIASMGDGKAVGRIGMKAMAWFIAASITSLLLGLLMANLLRPGDGMNLALPAAD
AASNLKTGALNLREFIAHMFPKSFVEAMATNEILQIVVFSLFFGFALGTLKDGIGKPVLA
GIEGLSHVMLKITNYVMAFAPVGVFGAVAAVITAEGLGVLVVYAKLLGAVYLSLALLWVA
LIAGGYFFLGRDVFRLLKMVRAPLMIGFATASSESAYPKVIEQLGRFGVKERITGFVLPL
GYSFNLDGSIMYTSFAALFVAQVYGIHLSLSQQVTMLLVLLVTSKGIAGVPRASLVVVAA
VLPMFGLPEAGILLVLGIDHVLDMGRTVTNVLGNAIATTVVAKSEGAIGAPVPEEADDPA
ADGNRGLTPVQVLAGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory