Comparing RR42_RS04230 FitnessBrowser__Cup4G11:RR42_RS04230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 88% coverage: 11:275/302 of query aligns to 2:273/294 of Q9X1K9
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
31% identity, 88% coverage: 11:275/302 of query aligns to 3:274/295 of 1o5kA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 94% coverage: 11:294/302 of query aligns to 2:289/292 of Q07607
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
32% identity, 95% coverage: 11:296/302 of query aligns to 5:295/295 of 5ktlA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
30% identity, 85% coverage: 18:275/302 of query aligns to 9:270/291 of 3pueB
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
30% identity, 88% coverage: 13:277/302 of query aligns to 6:275/296 of 7kg2A
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
30% identity, 88% coverage: 13:277/302 of query aligns to 6:275/296 of 4m19A
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
30% identity, 88% coverage: 13:277/302 of query aligns to 6:275/296 of 6u01B
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
30% identity, 88% coverage: 13:277/302 of query aligns to 16:285/306 of 7kkdB
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
32% identity, 92% coverage: 11:289/302 of query aligns to 3:290/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
32% identity, 92% coverage: 11:289/302 of query aligns to 2:289/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
32% identity, 92% coverage: 11:289/302 of query aligns to 2:289/292 of P0A6L2
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
36% identity, 76% coverage: 18:248/302 of query aligns to 15:247/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
36% identity, 76% coverage: 18:248/302 of query aligns to 16:248/297 of 5j5dA
Sites not aligning to the query:
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 76% coverage: 18:248/302 of query aligns to 19:251/300 of P9WP25
>RR42_RS04230 FitnessBrowser__Cup4G11:RR42_RS04230
MQAVDQVQQAFSGIWLPLVTPFADGSVDFPALARLVAHYAGSGIAGIVVCGSTGEAAALD
EAEQLAVLDTVLASAGSLPVMMGVAGSQVKQVQARVRRLAGLPLAGLLAPAPYYVRPSQA
GLLDYFRTLADSAAAPLVLYDIPYRTGVKLETETILALAAHPNIRAIKDCGGDYHGTQAV
IADARLSVLAGEDHQLLGTLCLGGAGAIIASAHLYPALFVALAQAVAGQRLEHARRLFHA
VMPVIKLLFAEPNPGPLKAMLAREGWTRNELRAPMKSAGAALEAALAQACERLGAVVPEL
LG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory