SitesBLAST
Comparing RR42_RS04315 FitnessBrowser__Cup4G11:RR42_RS04315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
71% identity, 99% coverage: 3:314/315 of query aligns to 5:317/321 of P0A9P4
- 36:43 (vs. 34:41, 63% identical) binding
- C136 (= C134) modified: Disulfide link with 139, Redox-active
- C139 (= C137) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 284:293, 90% identical) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
71% identity, 99% coverage: 3:314/315 of query aligns to 4:316/316 of 1tdfA
- active site: C135 (= C134), S138 (≠ C137), D139 (= D138)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (= S12), G14 (= G13), P15 (= P14), A16 (= A15), T35 (= T34), G36 (= G35), E38 (≠ A37), G41 (= G40), Q42 (= Q41), L43 (= L42), T46 (= T45), V49 (= V48), N51 (= N50), H83 (= H82), I84 (= I83), A111 (= A110), T112 (= T111), S138 (≠ C137), G285 (= G283), D286 (= D284), R293 (= R291), Q294 (= Q292), A295 (= A293), S298 (= S296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L118), I151 (≠ V150), T156 (= T155), E159 (= E158), H175 (= H174), R176 (= R175), R181 (= R180), E183 (= E182), I243 (= I241), G244 (= G242), H290 (= H288), R293 (= R291)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
71% identity, 99% coverage: 3:314/315 of query aligns to 4:316/320 of 1f6mA
- active site: S135 (≠ C134), C138 (= C137), D139 (= D138)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L118), G153 (= G152), G154 (= G153), N155 (= N154), T156 (= T155), E159 (= E158), H175 (= H174), R176 (= R175), R177 (= R176), R181 (= R180), I243 (= I241), G244 (= G242), H245 (= H243), R293 (= R291), Q294 (= Q292)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (= S12), G14 (= G13), P15 (= P14), A16 (= A15), T35 (= T34), G36 (= G35), E38 (≠ A37), G41 (= G40), Q42 (= Q41), L43 (= L42), T46 (= T45), V49 (= V48), N51 (= N50), H83 (= H82), I84 (= I83), A111 (= A110), T112 (= T111), G113 (= G112), H245 (= H243), G285 (= G283), D286 (= D284), R293 (= R291), Q294 (= Q292), A295 (= A293), S298 (= S296)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
68% identity, 99% coverage: 3:313/315 of query aligns to 8:318/319 of 5u63B
- active site: C139 (= C134), C142 (= C137), D143 (= D138)
- binding flavin-adenine dinucleotide: G16 (= G11), S17 (= S12), G18 (= G13), P19 (= P14), A20 (= A15), T39 (= T34), G40 (= G35), Q42 (≠ A37), G45 (= G40), Q46 (= Q41), L47 (= L42), T50 (= T45), N55 (= N50), H87 (= H82), I88 (= I83), A115 (= A110), T116 (= T111), G117 (= G112), H248 (= H243), G288 (= G283), D289 (= D284), R296 (= R291), Q297 (= Q292), A298 (= A293), S301 (= S296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ Q116), G157 (= G152), H179 (= H174), R180 (= R175), R181 (= R176), I246 (= I241), G247 (= G242), H248 (= H243), R296 (= R291)
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
67% identity, 99% coverage: 3:315/315 of query aligns to 7:319/319 of 5vt3B
- active site: C138 (= C134), C141 (= C137), D142 (= D138)
- binding flavin-adenine dinucleotide: G15 (= G11), S16 (= S12), G17 (= G13), P18 (= P14), A19 (= A15), T38 (= T34), G39 (= G35), Q41 (≠ A37), G44 (= G40), Q45 (= Q41), L46 (= L42), T49 (= T45), N54 (= N50), H86 (= H82), I87 (= I83), S114 (≠ A110), T115 (= T111), G116 (= G112), E162 (= E158), H247 (= H243), G287 (= G283), D288 (= D284), R295 (= R291), Q296 (= Q292), A297 (= A293), S300 (= S296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L118), G156 (= G152), G157 (= G153), N158 (= N154), T159 (= T155), H178 (= H174), R179 (= R175), R180 (= R176), R184 (= R180), I245 (= I241), G246 (= G242), R295 (= R291), Q296 (= Q292)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
59% identity, 99% coverage: 3:313/315 of query aligns to 5:313/315 of 4jnqA
- active site: C137 (= C134), C140 (= C137), D141 (= D138)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L10), G13 (= G11), S14 (= S12), G15 (= G13), P16 (= P14), A17 (= A15), A36 (≠ T34), G37 (= G35), Q39 (≠ A37), G42 (= G40), Q43 (= Q41), L44 (= L42), N52 (= N50), I85 (= I83), A113 (= A110), T114 (= T111), C140 (= C137), G283 (= G283), D284 (= D284), R291 (= R291), Q292 (= Q292), A293 (= A293)
Q92375 Thioredoxin reductase; Caffeine resistance protein 4; EC 1.8.1.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
49% identity, 99% coverage: 4:315/315 of query aligns to 3:319/322 of Q92375
- S192 (≠ E182) modified: Phosphoserine
- T278 (= T274) modified: Phosphothreonine
- S279 (= S275) modified: Phosphoserine
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
47% identity, 97% coverage: 7:311/315 of query aligns to 8:306/313 of 2a87A
- active site: F39 (≠ Q38), L43 (= L42), D48 (= D47), C136 (= C134), C139 (= C137), D140 (= D138)
- binding flavin-adenine dinucleotide: G12 (= G11), S13 (= S12), G14 (= G13), P15 (= P14), A16 (= A15), F34 (≠ I33), E35 (≠ T34), G36 (= G35), G40 (= G39), G41 (= G40), A42 (≠ Q41), L43 (= L42), T46 (= T45), V49 (= V48), N51 (= N50), D83 (≠ H82), V84 (≠ I83), M113 (≠ T111), C139 (= C137), G278 (= G283), D279 (= D284), R286 (= R291), Q287 (= Q292), A288 (= A293), V289 (≠ I294)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L118), G155 (= G153), D156 (≠ N154), S157 (≠ T155), H176 (= H174), R177 (= R175), R178 (= R176), R182 (= R180), I239 (= I241), Y259 (= Y260), R283 (≠ H288), R286 (= R291)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
47% identity, 97% coverage: 7:311/315 of query aligns to 17:315/335 of P9WHH1
- SGPA 22:25 (= SGPA 12:15) binding
- Y32 (= Y22) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 34:41, 38% identical) binding
- N60 (= N50) binding
- V93 (≠ I83) binding
- C145 (= C134) modified: Disulfide link with 148, Redox-active
- C148 (= C137) modified: Disulfide link with 145, Redox-active
- S166 (≠ T155) binding
- H185 (= H174) binding
- R191 (= R180) binding
- I248 (= I241) binding
- Y268 (= Y260) binding
- D288 (= D284) binding
- R295 (= R291) binding
- RQAV 295:298 (≠ RQAI 291:294) binding
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
48% identity, 97% coverage: 7:311/315 of query aligns to 5:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (≠ T34), G33 (= G35), Q35 (≠ A37), G38 (= G40), A39 (≠ Q41), L40 (= L42), T43 (= T45), N48 (= N50), D80 (≠ H82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ A133), C135 (= C137), G274 (= G283), D275 (= D284), R282 (= R291), Q283 (= Q292), A284 (= A293), A287 (≠ S296)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ Q116), H115 (≠ Y117), L116 (= L118), R173 (= R175), E200 (≠ V205), I201 (≠ L206), I235 (= I241)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
48% identity, 97% coverage: 7:311/315 of query aligns to 5:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (≠ T34), G33 (= G35), Q35 (≠ A37), G38 (= G40), A39 (≠ Q41), L40 (= L42), T43 (= T45), N48 (= N50), D80 (≠ H82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ A133), C135 (= C137), G274 (= G283), D275 (= D284), R282 (= R291), Q283 (= Q292), A284 (= A293), A287 (≠ S296)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L118), R173 (= R175), E200 (≠ V205), I201 (≠ L206)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
48% identity, 97% coverage: 7:311/315 of query aligns to 5:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (≠ T34), G33 (= G35), Q35 (≠ A37), G38 (= G40), A39 (≠ Q41), L40 (= L42), T43 (= T45), N48 (= N50), D80 (≠ H82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ A133), C135 (= C137), G274 (= G283), D275 (= D284), R282 (= R291), Q283 (= Q292), A284 (= A293), A287 (≠ S296)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ Q116), H115 (≠ Y117), L116 (= L118), V148 (= V150), R173 (= R175), E200 (≠ V205), I201 (≠ L206)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
48% identity, 97% coverage: 7:311/315 of query aligns to 5:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), E32 (≠ T34), G33 (= G35), Q35 (≠ A37), G38 (= G40), A39 (≠ Q41), L40 (= L42), T43 (= T45), N48 (= N50), D80 (≠ H82), V81 (≠ I83), M109 (≠ T111), G110 (= G112), T131 (≠ A133), C135 (= C137), G274 (= G283), D275 (= D284), R282 (= R291), Q283 (= Q292), A284 (= A293), A287 (≠ S296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G152), G151 (= G153), D152 (≠ N154), S153 (≠ T155), E156 (= E158), H172 (= H174), R173 (= R175), R174 (= R176), R178 (= R180), I235 (= I241)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
48% identity, 97% coverage: 7:311/315 of query aligns to 6:303/306 of 5uthA
- active site: C133 (= C134), C136 (= C137), D137 (= D138)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), F32 (≠ I33), E33 (≠ T34), G34 (= G35), Q36 (≠ A37), G39 (= G40), A40 (≠ Q41), L41 (= L42), N49 (= N50), D81 (≠ H82), V82 (≠ I83), M110 (≠ T111), G111 (= G112), C136 (= C137), G275 (= G283), D276 (= D284), R283 (= R291), Q284 (= Q292), A285 (= A293), A288 (≠ S296)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
48% identity, 98% coverage: 4:311/315 of query aligns to 17:330/356 of 5w4cA
- binding calcium ion: E99 (≠ D81), E116 (≠ D98), E118 (≠ G100)
- binding flavin-adenine dinucleotide: I23 (≠ L10), G24 (= G11), S25 (= S12), P27 (= P14), G28 (≠ A15), Y46 (≠ I33), G48 (= G35), A51 (vs. gap), F54 (vs. gap), G58 (= G40), Q59 (= Q41), L60 (= L42), T63 (= T45), N68 (= N50), V101 (≠ I83), T134 (= T111), G135 (= G112), G302 (= G283), D303 (= D284), R310 (= R291), Q311 (= Q292), A312 (= A293), S315 (= S296)
Sites not aligning to the query:
P29509 Thioredoxin reductase 1; TR; TrxR; Thioredoxin peroxidase 1; TPx; Thioredoxin-dependent peroxide reductase 1; EC 1.8.1.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
46% identity, 99% coverage: 4:315/315 of query aligns to 3:319/319 of P29509
- SGPA 11:14 (= SGPA 12:15) binding
- IA 40:41 (≠ LA 36:37) binding
- Q45 (= Q41) binding
- N54 (= N50) binding
- V87 (≠ I83) binding
- C142 (= C134) modified: Disulfide link with 145, Redox-active
- C145 (= C137) binding ; modified: Disulfide link with 142, Redox-active
- D288 (= D284) binding
- RQA 295:297 (= RQA 291:293) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3d8xA Crystal structure of saccharomyces cerevisiae ndpph dependent thioredoxin reductase 1 (see paper)
46% identity, 99% coverage: 4:315/315 of query aligns to 2:318/318 of 3d8xA
- active site: C141 (= C134), C144 (= C137), D145 (= D138)
- binding flavin-adenine dinucleotide: I8 (≠ L10), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), Y31 (≠ I33), G33 (vs. gap), A36 (vs. gap), I39 (≠ L36), G43 (= G40), Q44 (= Q41), I51 (≠ V48), N53 (= N50), T85 (≠ H82), V86 (≠ I83), T118 (= T111), G119 (= G112), C144 (= C137), G286 (= G283), D287 (= D284), R294 (= R291), Q295 (= Q292), A296 (= A293), S299 (= S296)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M125 (≠ L118), G160 (= G151), S164 (≠ T155), R184 (= R175), K185 (≠ R176), R189 (= R180), I247 (= I241)
3itjB Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) (see paper)
46% identity, 99% coverage: 4:315/315 of query aligns to 3:319/319 of 3itjB
- active site: C142 (= C134), C145 (= C137), D146 (= D138)
- binding flavin-adenine dinucleotide: I9 (≠ L10), G10 (= G11), S11 (= S12), G12 (= G13), P13 (= P14), A14 (= A15), Y32 (≠ I33), E33 (vs. gap), G34 (vs. gap), A37 (vs. gap), I40 (≠ L36), A41 (= A37), G44 (= G40), Q45 (= Q41), T49 (= T45), I52 (≠ V48), N54 (= N50), T86 (≠ H82), V87 (≠ I83), T119 (= T111), G120 (= G112), W135 (≠ M127), C145 (= C137), G287 (= G283), D288 (= D284), R295 (= R291), Q296 (= Q292), A297 (= A293), S300 (= S296)
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
47% identity, 98% coverage: 6:313/315 of query aligns to 3:306/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G11), S9 (= S12), G10 (= G13), P11 (= P14), A12 (= A15), E31 (≠ T34), G32 (= G35), N35 (vs. gap), G36 (≠ A37), G39 (= G40), Q40 (= Q41), L41 (= L42), T44 (= T45), N49 (= N50), D81 (≠ H82), V82 (≠ I83), A109 (= A110), T110 (= T111), W126 (≠ M127), S136 (≠ C137), G276 (= G283), D277 (= D284), R284 (= R291), Q285 (= Q292), A286 (= A293), A289 (≠ S296)
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
46% identity, 98% coverage: 4:311/315 of query aligns to 2:319/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L10), G9 (= G11), S10 (= S12), G11 (= G13), P12 (= P14), A13 (= A15), Y31 (≠ I33), E32 (≠ T34), G33 (= G35), A36 (vs. gap), T38 (vs. gap), A39 (= A37), G42 (= G40), Q43 (= Q41), L44 (= L42), T47 (= T45), I50 (≠ V48), N52 (= N50), T84 (≠ H82), I85 (= I83), T120 (= T111), G121 (= G112), C146 (= C137), G291 (= G283), D292 (= D284), R299 (= R291), Q300 (= Q292), A301 (= A293), S304 (= S296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G152), G164 (= G153), S166 (≠ T155), R186 (= R175), R187 (= R176), R191 (= R180), V252 (≠ I241)
Query Sequence
>RR42_RS04315 FitnessBrowser__Cup4G11:RR42_RS04315
MAKHAKVLILGSGPAGYTAAVYAARANLQPVLITGLAQGGQLMTTTDVENWPADANGVQG
PELMQRFLEHAERFNTEIIFDHIHTAKLTERPIRLVGDAGEYTCDSLIIATGASAQYLGL
PSEELFMGRGVSACATCDGFFYKNQEVAVVGGGNTAVEEALYLSQIASKVTVLHRRDKFR
AEPILVDRLLQREKEGRVEIRWNSVLEEVTGDDSGVTGLKVRNVNTGTVEDLKLAGVFVA
IGHKPNTELFEGQLEMHNGYIVTKSGLAGDATATSIPGVFAAGDVQDHIYRQAITSAGTG
CMAALDAQRYVEALQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory