Comparing RR42_RS04395 FitnessBrowser__Cup4G11:RR42_RS04395 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
42% identity, 84% coverage: 37:258/265 of query aligns to 4:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
42% identity, 83% coverage: 37:257/265 of query aligns to 4:226/226 of 4zv1A
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
35% identity, 87% coverage: 30:260/265 of query aligns to 6:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
35% identity, 87% coverage: 30:260/265 of query aligns to 10:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
35% identity, 87% coverage: 30:260/265 of query aligns to 10:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
35% identity, 87% coverage: 30:260/265 of query aligns to 10:238/241 of 3vvdA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
38% identity, 90% coverage: 24:261/265 of query aligns to 1:238/240 of 2ylnA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 86% coverage: 30:256/265 of query aligns to 3:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
31% identity, 86% coverage: 30:256/265 of query aligns to 3:227/229 of 6svfA
8gu1A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with pimozide (see paper)
33% identity, 84% coverage: 39:260/265 of query aligns to 3:225/234 of 8gu1A
6aalA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with arginine (see paper)
33% identity, 84% coverage: 39:260/265 of query aligns to 3:225/234 of 6aalA
6a80A Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with cystine (see paper)
33% identity, 84% coverage: 39:260/265 of query aligns to 3:225/234 of 6a80A
8gtuA Crystal structure of putative amino acid binding periplasmic abc transporter protein from candidatus liberibacter asiaticus in complex with clidinium (see paper)
33% identity, 84% coverage: 39:260/265 of query aligns to 5:227/236 of 8gtuA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
29% identity, 83% coverage: 37:256/265 of query aligns to 1:222/224 of 4ymxA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
28% identity, 88% coverage: 30:262/265 of query aligns to 1:237/237 of 4i62A
5ovzA High resolution structure of the pbp noct in complex with nopaline (see paper)
28% identity, 84% coverage: 39:261/265 of query aligns to 5:254/259 of 5ovzA
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
28% identity, 84% coverage: 39:261/265 of query aligns to 4:253/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
28% identity, 84% coverage: 39:261/265 of query aligns to 4:253/254 of 5ot9A
4powA Structure of the pbp noct in complex with pyronopaline (see paper)
28% identity, 84% coverage: 39:261/265 of query aligns to 4:253/254 of 4powA
5otcA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with noroctopinic acid. (see paper)
28% identity, 84% coverage: 39:261/265 of query aligns to 4:253/256 of 5otcA
>RR42_RS04395 FitnessBrowser__Cup4G11:RR42_RS04395
MRSLRTGCLNALFAVSLLAAGAAAQAADLLDTVKQAGVLKIGLEGTYPPFNYRGSNNQLE
GFDVDVAKGVAAKLGVKPEFVTTEWSGIIAGLQAGKFDVIVNQVAVTPQRKQVLDFSTPY
VYSAAQLIQRKDDNRQFKSLEDLKGKKLGVSLGSNYNELAKSVAGIDVKTYPGAPEYLRD
LAAQRVDAALNDRLMIGYLIKTSNLPLRPGAIVEGGNSEVAIPFRKDNPKFAQAIDRALD
EMRKDGSLGKLSARWFGSDVTKPAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory