Comparing RR42_RS04465 FitnessBrowser__Cup4G11:RR42_RS04465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
37% identity, 87% coverage: 40:363/371 of query aligns to 25:343/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
37% identity, 87% coverage: 40:363/371 of query aligns to 25:343/353 of 4r2nA
Sites not aligning to the query:
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
29% identity, 97% coverage: 8:368/371 of query aligns to 3:358/360 of 8bj3A
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
33% identity, 89% coverage: 40:371/371 of query aligns to 30:363/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
33% identity, 89% coverage: 40:371/371 of query aligns to 28:361/364 of 3cq6A
Sites not aligning to the query:
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
32% identity, 86% coverage: 40:358/371 of query aligns to 19:337/354 of 3ly1D
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
34% identity, 88% coverage: 40:365/371 of query aligns to 30:357/369 of 4r8dA
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 94% coverage: 22:370/371 of query aligns to 9:357/364 of P97084
Sites not aligning to the query:
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
30% identity, 94% coverage: 22:370/371 of query aligns to 3:351/356 of 1lc8A
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
30% identity, 94% coverage: 22:370/371 of query aligns to 6:354/358 of 1lc7A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
30% identity, 94% coverage: 22:370/371 of query aligns to 2:350/355 of 1lkcA
Sites not aligning to the query:
4wbtA Crystal structure of histidinol-phosphate aminotransferase from sinorhizobium meliloti in complex with pyridoxal-5'-phosphate
31% identity, 89% coverage: 41:371/371 of query aligns to 35:366/369 of 4wbtA
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 88% coverage: 42:367/371 of query aligns to 18:326/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
30% identity, 88% coverage: 42:367/371 of query aligns to 19:327/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
30% identity, 88% coverage: 42:367/371 of query aligns to 19:327/329 of 1h1cA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
31% identity, 88% coverage: 42:367/371 of query aligns to 24:332/335 of Q9X0D0
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
31% identity, 88% coverage: 42:367/371 of query aligns to 25:333/335 of 2f8jA
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 96% coverage: 11:366/371 of query aligns to 10:349/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 96% coverage: 11:366/371 of query aligns to 10:349/354 of 1fg3A
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
30% identity, 81% coverage: 66:366/371 of query aligns to 36:335/335 of 1geyA
Sites not aligning to the query:
>RR42_RS04465 FitnessBrowser__Cup4G11:RR42_RS04465
MAEQGKQFGPEYVRAISPYVAGKPISEVAREFGLVESTIVKLASNENPLGMPESARTAIA
AAVADLGRYPDANGFALKGALSARFDVPPDWLTLGNGSNDILEIAAHALVKPGESIVYAE
HSFAVYALATQEVGARAIEVKARDYGHDLDAMAVAIAPDTRLVFIANPNNPTGTFLPAAE
IETFLAKVPADVVVVLDEAYNEYLDDAQQYDSIAWVRKYPNLLVSRTFSKAYGLAGLRIG
YAVAQPALTDLLNRIRQPFNVNSLAQAAAVAALGDAAFLQRSAELNRAGKAQLVAAFDRL
GLQYVPSSGNFVLVRVGRDDGAGARVNLALLKQGVIVRPVGNYNLPQWLRITIGLPEENA
AFIAALEKALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory