Comparing RR42_RS04470 FitnessBrowser__Cup4G11:RR42_RS04470 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
38% identity, 92% coverage: 13:289/302 of query aligns to 16:292/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
38% identity, 92% coverage: 13:289/302 of query aligns to 8:284/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
38% identity, 92% coverage: 13:289/302 of query aligns to 8:284/286 of 3ggpA
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
38% identity, 92% coverage: 10:288/302 of query aligns to 4:284/293 of 4wjiA
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
37% identity, 96% coverage: 11:300/302 of query aligns to 2:292/365 of 6u60B
Sites not aligning to the query:
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
37% identity, 96% coverage: 11:300/302 of query aligns to 10:300/373 of 5uyyA
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
34% identity, 92% coverage: 13:289/302 of query aligns to 9:284/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
33% identity, 92% coverage: 12:290/302 of query aligns to 2:277/279 of 2f1kA
>RR42_RS04470 FitnessBrowser__Cup4G11:RR42_RS04470
MTVPASAPFFSRVVIVGVGLIGGSLALALKRAGAVGTVVGVGRSQASLERALKLGVIDEA
ATLEDAAKGASMIVLCAPVAQTFALLHALEPHLEPATIITDAGSTKSDVIMAAKTALGDK
AAQFVPAHPIAGRELHGVEAALDDLYVGKKVVLCPLQENTRIDVAGVRAMWETAGAQCSV
MSAVQHDAVFAAVSHLPHLLSYALVAQVANAEDAALKLDFAGGGFRDFTRIAASSPEMWR
DICVGNREAMLSELSTYQAMLAHLKTLIENSNGEGLERIFQRASQARQQWGAQRAPAVNA
EP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory