Comparing RR42_RS04535 FitnessBrowser__Cup4G11:RR42_RS04535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
62% identity, 98% coverage: 5:298/300 of query aligns to 3:292/303 of P16703
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
62% identity, 98% coverage: 5:298/300 of query aligns to 3:292/294 of 2bhtA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
44% identity, 99% coverage: 3:298/300 of query aligns to 5:306/310 of 5xoqA
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
46% identity, 98% coverage: 6:298/300 of query aligns to 7:305/306 of 2q3dA
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 98% coverage: 6:298/300 of query aligns to 7:305/310 of P9WP55
3bm5A Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
43% identity, 99% coverage: 3:298/300 of query aligns to 13:318/338 of 3bm5A
4jblB Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with methionine (see paper)
43% identity, 99% coverage: 3:298/300 of query aligns to 13:318/335 of 4jblB
3bm5B Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
43% identity, 99% coverage: 3:298/300 of query aligns to 13:318/335 of 3bm5B
4jbnA Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with serine acetyl transferase derived tetrapeptide, spsi (see paper)
43% identity, 99% coverage: 3:298/300 of query aligns to 13:318/336 of 4jbnA
4il5A Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with isoleucine (see paper)
43% identity, 99% coverage: 3:298/300 of query aligns to 13:318/336 of 4il5A
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
43% identity, 99% coverage: 4:300/300 of query aligns to 7:310/322 of P47998
2isqA Crystal structure of o-acetylserine sulfhydrylase from arabidopsis thaliana in complex with c-terminal peptide from arabidopsis serine acetyltransferase (see paper)
43% identity, 99% coverage: 4:300/300 of query aligns to 5:308/320 of 2isqA
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
45% identity, 96% coverage: 6:293/300 of query aligns to 7:300/300 of 3zeiA
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
45% identity, 96% coverage: 6:293/300 of query aligns to 7:300/300 of 2q3cA
P9WP53 O-phosphoserine sulfhydrylase; OPS sulfhydrylase; CysO-thiocarboxylate-dependent cysteine synthase; Cysteine synthase B; CSase B; O-phosphoserine-specific cysteine synthase; [CysO sulfur-carrier protein]-thiocarboxylate-dependent cysteine synthase; EC 2.5.1.113 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
42% identity, 99% coverage: 3:298/300 of query aligns to 4:306/323 of P9WP53
Sites not aligning to the query:
1z7yA Crystal structure of the arabidopsis thaliana o-acetylserine sulfhydrylase k46a mutant (see paper)
43% identity, 99% coverage: 4:300/300 of query aligns to 5:308/320 of 1z7yA
3dwgA Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of mycobacterium tuberculosis (see paper)
42% identity, 99% coverage: 3:298/300 of query aligns to 6:308/325 of 3dwgA
3vbeC Crystal structure of beta-cyanoalanine synthase in soybean (see paper)
42% identity, 98% coverage: 4:298/300 of query aligns to 13:314/329 of 3vbeC
7xoyA Cystathionine beta-synthase of mycobacterium tuberculosis in the presence of s-adenosylmethionine and serine. (see paper)
45% identity, 97% coverage: 4:294/300 of query aligns to 3:301/458 of 7xoyA
7xnzB Native cystathionine beta-synthase of mycobacterium tuberculosis. (see paper)
45% identity, 97% coverage: 4:294/300 of query aligns to 3:301/458 of 7xnzB
>RR42_RS04535 FitnessBrowser__Cup4G11:RR42_RS04535
MAYKTIEDTIGNTPLVQLQRIPGGAGAPRGNVILGKLEGNNPAGSVKDRPAVSMIARAES
RGRIKPGDTLIEATSGNTGIALAMAAAIRGYKMVLIMPEDLSMERRQSMAAYGAEIILTP
VKGGMEYARDLADSMERDGRGVILDQFANPDNPLAHYETTGPEIWLDTEGRITHFVSAMG
TTGTITGVSRYLKEQNAGIQIVGAQPAEGSRIPGIRKWPEAYMPKIYDPKFIDRTEPVSQ
GDAEHMARRMAREEGIFCGISAAGALCVALRIAEEVENATIVFVVCDRGDRYLSTGVFPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory