Comparing RR42_RS04560 FitnessBrowser__Cup4G11:RR42_RS04560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
34% identity, 51% coverage: 64:173/217 of query aligns to 62:165/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
27% identity, 73% coverage: 2:159/217 of query aligns to 46:189/553 of B5Z7I3
Sites not aligning to the query:
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
30% identity, 38% coverage: 90:172/217 of query aligns to 89:171/215 of 4ymtC
Sites not aligning to the query:
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
30% identity, 38% coverage: 90:172/217 of query aligns to 89:171/214 of 4ymwC
>RR42_RS04560 FitnessBrowser__Cup4G11:RR42_RS04560
MWSEMFDLFLTSFNETLLMVSISGVVGALFGVPLGVLLHLTNRGGVLSHPLFNRTIGVVV
NAVRSIPFIILLVVVIPFTRFIVGSSIGTTAAVVPLTIAAIPFIARLVESALREVDKGLV
EAAQSMGASTGQIVMKVLLPEAMPGIVAGLTITFVSLVGYSAMAGAIGGGGLGDLGIRYG
YQRYITEVMVAVVLILIVFVQAVQSFGDWLVRRISHK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory