SitesBLAST
Comparing RR42_RS04585 FitnessBrowser__Cup4G11:RR42_RS04585 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
27% identity, 72% coverage: 108:420/434 of query aligns to 62:371/377 of Q5L2C2
- V180 (≠ S223) binding
- R309 (= R359) binding
- 334:340 (vs. 383:389, 29% identical) binding
- R336 (≠ T385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 69% coverage: 122:421/434 of query aligns to 72:363/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (≠ I224), G200 (≠ L253), G201 (= G254), W203 (= W256), G298 (= G357), R300 (= R359), P301 (= P360), Y326 (≠ G384), R327 (≠ T385), N328 (≠ L386), G329 (= G387), I330 (≠ W388)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 72% coverage: 108:420/434 of query aligns to 61:369/370 of 4yshA
- active site: I262 (≠ V314), L283 (= L335), G305 (= G357), N335 (≠ L386), L338 (≠ T389)
- binding flavin-adenine dinucleotide: V178 (≠ S223), S206 (≠ L253), G207 (= G254), W209 (= W256), R307 (= R359), H332 (= H383), R334 (≠ T385), N335 (≠ L386), G336 (= G387), I337 (≠ W388)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 72% coverage: 108:419/434 of query aligns to 61:368/368 of 4yshB
- active site: I262 (≠ V314), L283 (= L335), G305 (= G357), N335 (≠ L386), L338 (≠ T389)
- binding flavin-adenine dinucleotide: V178 (≠ S223), S206 (≠ L253), W209 (= W256), R307 (= R359), H332 (= H383), R334 (≠ T385), N335 (≠ L386), G336 (= G387), I337 (≠ W388), L338 (≠ T389)
- binding glycine: G249 (≠ F301), Y251 (≠ V303), Y251 (≠ V303), A264 (≠ G316), R307 (= R359), R334 (≠ T385), R334 (≠ T385)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 72% coverage: 108:419/434 of query aligns to 81:400/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 75% coverage: 94:419/434 of query aligns to 44:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (= M94), P46 (≠ C96), N49 (≠ E99), R243 (≠ S294), Y252 (≠ V303), Y267 (≠ A318), R308 (= R359), R334 (≠ T385), I335 (≠ L386)
- binding flavin-adenine dinucleotide: M44 (= M94), A174 (≠ S223), A203 (≠ L253), W206 (= W256), I228 (≠ S280), Y252 (≠ V303), R308 (= R359), S333 (≠ G384), R334 (≠ T385), I335 (≠ L386), G336 (= G387), V337 (≠ W388), Q338 (≠ T389)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43
6j38A Crystal structure of cmis2 (see paper)
27% identity, 75% coverage: 94:419/434 of query aligns to 44:368/368 of 6j38A
- binding flavin-adenine dinucleotide: M44 (= M94), A174 (≠ S223), A203 (≠ L253), W206 (= W256), G226 (= G278), G306 (= G357), R308 (= R359), S333 (≠ G384), R334 (≠ T385), I335 (≠ L386), G336 (= G387), V337 (≠ W388), Q338 (≠ T389)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
22% identity, 70% coverage: 100:403/434 of query aligns to 51:352/374 of 1y56B
- active site: H224 (≠ G278), P239 (= P292), G305 (= G357), M338 (≠ T389)
- binding flavin-adenine dinucleotide: E170 (≠ S223), V171 (≠ I224), T200 (≠ L253), N201 (≠ G254), W203 (= W256), G305 (= G357), Y306 (≠ L358), Y307 (≠ R359), G334 (≠ T385), H335 (≠ L386), G336 (= G387), F337 (≠ W388), M338 (≠ T389)
- binding flavin mononucleotide: I260 (≠ R313), R301 (≠ S353), W303 (= W355)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
27% identity, 54% coverage: 168:402/434 of query aligns to 121:346/369 of O31616
- V174 (≠ I224) binding
- H244 (≠ F301) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R359) binding
- 327:333 (vs. 383:389, 29% identical) binding
- R329 (≠ T385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
27% identity, 54% coverage: 168:402/434 of query aligns to 121:346/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V303), R302 (= R359), R329 (≠ T385)
- binding flavin-adenine dinucleotide: V174 (≠ I224), S202 (≠ L253), G203 (= G254), W205 (= W256), F209 (= F260), G300 (= G357), R302 (= R359), H327 (= H383), R329 (≠ T385), N330 (≠ L386), G331 (= G387), I332 (≠ W388)
- binding phosphate ion: R254 (= R311)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 54% coverage: 168:402/434 of query aligns to 121:346/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ S223), V174 (≠ I224), S202 (≠ L253), G203 (= G254), W205 (= W256), F209 (= F260), G300 (= G357), R302 (= R359), H327 (= H383), F328 (≠ G384), R329 (≠ T385), N330 (≠ L386), G331 (= G387), I332 (≠ W388)
- binding glycolic acid: Y246 (≠ V303), R302 (= R359), R329 (≠ T385)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
29% identity, 38% coverage: 241:404/434 of query aligns to 191:353/370 of 6pxsA
- binding flavin-adenine dinucleotide: A203 (≠ L253), W206 (= W256), I210 (≠ F260), Y250 (≠ F301), G305 (= G357), R307 (= R359), G333 (= G384), A334 (≠ T385), S335 (≠ L386), G336 (= G387), L337 (≠ W388), T338 (= T389)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 30, 32, 33, 36, 37, 38, 40, 41, 42, 43, 44, 174
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
20% identity, 69% coverage: 134:434/434 of query aligns to 104:401/405 of Q50LF2
- K172 (≠ D199) mutation to A: Retains 39% of wild-type activity.; mutation to D: Retains 32% of wild-type activity.; mutation to R: Retains 58% of wild-type activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine
- V197 (≠ I224) binding
- H270 (≠ T306) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ F308) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G384) binding
- G357 (= G387) binding
- K359 (≠ T389) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
20% identity, 69% coverage: 134:434/434 of query aligns to 103:400/402 of 1vrqB
- active site: G326 (= G357), K358 (≠ T389)
- binding n,n-dimethylglycine: K358 (≠ T389)
- binding flavin-adenine dinucleotide: V196 (≠ I224), A224 (= A252), G225 (≠ L253), H228 (≠ W256), L247 (≠ V293), G353 (= G384), T354 (= T385), G355 (≠ L386), G356 (= G387), F357 (≠ W388), K358 (≠ T389)
- binding flavin mononucleotide: H172 (≠ C200), V251 (≠ L297), E279 (≠ G316), R322 (≠ S353), W324 (= W355)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
20% identity, 66% coverage: 134:419/434 of query aligns to 103:388/404 of 3ad8B
- active site: G326 (= G357), K358 (≠ T389)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (≠ L253), A226 (≠ G254), H228 (≠ W256), L247 (≠ V293), G353 (= G384), T354 (= T385), G355 (≠ L386), G356 (= G387), F357 (≠ W388), K358 (≠ T389)
- binding flavin mononucleotide: H172 (≠ C200), V251 (≠ L297), E279 (≠ G316), R322 (≠ S353), W324 (= W355)
- binding pyrrole-2-carboxylate: M264 (vs. gap), Y271 (≠ F308), T354 (= T385), K358 (≠ T389)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
20% identity, 66% coverage: 134:419/434 of query aligns to 103:388/404 of 3ad7B
- active site: G326 (= G357), K358 (≠ T389)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (≠ L253), A226 (≠ G254), H228 (≠ W256), L247 (≠ V293), G353 (= G384), T354 (= T385), G355 (≠ L386), G356 (= G387), F357 (≠ W388), K358 (≠ T389)
- binding flavin mononucleotide: H172 (≠ C200), V251 (≠ L297), K277 (≠ V314), E279 (≠ G316), R322 (≠ S353), W324 (= W355)
- binding [methylthio]acetate: M264 (vs. gap), Y271 (≠ F308), T354 (= T385), K358 (≠ T389)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63
- binding [methylthio]acetate: 67, 69, 402
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
27% identity, 37% coverage: 246:405/434 of query aligns to 195:349/369 of S5FMM4
- S202 (≠ L253) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W388) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L398) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
20% identity, 69% coverage: 134:434/434 of query aligns to 102:399/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (≠ I224), G224 (≠ L253), A225 (≠ G254), H227 (≠ W256), L231 (≠ F260), L246 (≠ V293), G352 (= G384), T353 (= T385), G354 (≠ L386), G355 (= G387), F356 (≠ W388), K357 (≠ T389)
- binding flavin mononucleotide: H171 (≠ C200), V250 (≠ L297), E278 (≠ G316), R321 (≠ S353), W323 (= W355)
- binding 2-furoic acid: M263 (vs. gap), Y270 (≠ F308), K357 (≠ T389)
- binding sulfite ion: K170 (≠ D199), K276 (≠ V314)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
20% identity, 69% coverage: 134:434/434 of query aligns to 104:401/405 of P40875
- C146 (≠ E176) mutation to S: No change in activity.
- H173 (≠ C200) modified: Tele-8alpha-FMN histidine; mutation to N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- H175 (≠ L202) mutation to A: No effect on FMN binding and activity.
- C195 (≠ R222) mutation to S: No change in activity.
- C351 (≠ T381) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
22% identity, 61% coverage: 108:373/434 of query aligns to 60:347/828 of 1pj6A
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 358, 359, 360, 361
Query Sequence
>RR42_RS04585 FitnessBrowser__Cup4G11:RR42_RS04585
MRVLVLGSGVIGVTSAWYLARAGHEVTVIDREAAPALGTSFANAGQISPGYASPWAAPGV
PLKAIKWMFQEHAPLSIKPDGTLFQLQWMWQMLMNCSAERYAVNKERMVRLAEYSRDCIV
ALRADTGIAYEGRQQGTLQLFRTAEQLDGAAKDIAVLEQAGVPYQLLSREELAASEPALA
AVSHKLTGGLRLPNDETGDCQLFTGQLAAMAEGLGVQFQYNRSIDGLLTKGDAITGAMVG
GEPVMADLVVVALGSWSTPFVKNFLPGLSNLPVYPLKGFSLTVPMTNADRSPVSTVLDET
FKVAITRFDDRIRVGGMAQIVGYDRTLDPAKRRTLEHVVTDLFPGAGDVSRASFWTGLRP
MTPDGTPIVGPTQVKGLWLNTGHGTLGWTMACGSGKLLSDLVSGTSPAIRADDLSVARYL
KPARTHAAPRHAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory