SitesBLAST
Comparing RR42_RS04800 FitnessBrowser__Cup4G11:RR42_RS04800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
34% identity, 93% coverage: 9:502/529 of query aligns to 5:485/501 of P04983
- K43 (= K47) mutation to R: Loss of transport.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 43% coverage: 9:237/529 of query aligns to 2:222/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y18), V16 (≠ A23), S36 (≠ N43), G37 (= G44), S38 (≠ A45), G39 (= G46), K40 (= K47), S41 (= S48), T42 (= T49), E162 (= E177), H194 (= H209)
- binding magnesium ion: S41 (= S48), E162 (= E177)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 46% coverage: 9:253/529 of query aligns to 7:247/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 44% coverage: 4:237/529 of query aligns to 13:234/378 of P69874
- C26 (≠ R17) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y18) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ I36) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A45) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ M51) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ F67) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ Y139) mutation to M: Loss of ATPase activity and transport.
- D172 (= D176) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
31% identity, 42% coverage: 9:230/529 of query aligns to 4:218/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
31% identity, 42% coverage: 9:230/529 of query aligns to 4:218/230 of 6z4wA
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
30% identity, 46% coverage: 9:249/529 of query aligns to 1:229/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y18), S35 (≠ N43), G36 (= G44), C37 (≠ A45), G38 (= G46), K39 (= K47), S40 (= S48), T41 (= T49), R126 (= R147), A130 (≠ T151), S132 (= S153), G134 (= G155), Q135 (≠ E156)
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 43% coverage: 8:237/529 of query aligns to 3:227/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 43% coverage: 8:237/529 of query aligns to 3:227/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 43% coverage: 8:237/529 of query aligns to 3:227/353 of 1oxuA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
30% identity, 45% coverage: 11:249/529 of query aligns to 5:231/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
30% identity, 45% coverage: 11:249/529 of query aligns to 5:231/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y18), S37 (≠ N43), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), Q81 (= Q90), R128 (= R147), A132 (≠ T151), S134 (= S153), G136 (= G155), Q137 (≠ E156), E158 (= E177), H191 (= H209)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
30% identity, 45% coverage: 11:249/529 of query aligns to 5:231/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (= R147), S134 (= S153), Q137 (≠ E156)
- binding beryllium trifluoride ion: S37 (≠ N43), G38 (= G44), K41 (= K47), Q81 (= Q90), S134 (= S153), G136 (= G155), H191 (= H209)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
30% identity, 45% coverage: 11:249/529 of query aligns to 5:231/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), V17 (≠ A23), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (= R147), A132 (≠ T151), S134 (= S153), Q137 (≠ E156)
- binding tetrafluoroaluminate ion: S37 (≠ N43), G38 (= G44), K41 (= K47), Q81 (= Q90), S134 (= S153), G135 (≠ V154), G136 (= G155), E158 (= E177), H191 (= H209)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
30% identity, 45% coverage: 11:249/529 of query aligns to 5:231/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y18), V17 (≠ A23), G38 (= G44), C39 (≠ A45), G40 (= G46), K41 (= K47), S42 (= S48), T43 (= T49), R128 (= R147), A132 (≠ T151), S134 (= S153), Q137 (≠ E156)
- binding magnesium ion: S42 (= S48), Q81 (= Q90)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 46% coverage: 9:249/529 of query aligns to 4:232/371 of P68187
- A85 (≠ S93) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ N124) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ I132) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ T135) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ L137) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ P142) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G155) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D176) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R245) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 43% coverage: 9:236/529 of query aligns to 3:221/240 of 6mjpA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 9:230/529 of query aligns to 6:224/233 of P75957
- G42 (= G41) mutation to D: Loss of lipoprotein release when overexpressed.
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 42% coverage: 9:230/529 of query aligns to 3:221/222 of 7arlD
7mdyC Lolcde nucleotide-bound
32% identity, 42% coverage: 9:230/529 of query aligns to 3:221/226 of 7mdyC
- binding adp orthovanadate: Y12 (= Y18), G42 (= G44), S43 (≠ A45), G44 (= G46), K45 (= K47), S46 (= S48), T47 (= T49), Q91 (= Q90), H138 (≠ R147), E142 (≠ T151), S144 (= S153), G145 (≠ V154), G146 (= G155), E168 (= E177), N172 (≠ V181), H201 (= H209)
- binding magnesium ion: S46 (= S48), Q91 (= Q90)
Query Sequence
>RR42_RS04800 FitnessBrowser__Cup4G11:RR42_RS04800
MTLSTTPRLALAHISKRYPGVTANDDVSLVVAPGEIHAVLGENGAGKSTLMKIIFGAVKP
DAGDMHFNGARAAIHNPHDARNLGIAMVFQHFSLFDTLTVAENIALGLPRGSKTAAGSPH
AGTNMKQLAEQIRETALRYGLPLEPNRHVHTLSVGERQRVEIVRALLAKPQLLILDEPTS
VLTPQAVQTLFITLRQLAAEGTSILYISHKLDEIRELCHSATVMRMGRVTGVCDPRQESA
ASLSRLMIGGEPPREARVQTEPGVCRLAVRELSLPRSHAFATELAGISLDLRAGEIVGIA
GVSGNGQQELLAALSGEDVRAARDAITLDNKPVGKLDARQRRRAGLAFVPEERLGRGAVP
GMSLAANILLSHQSAPYVQRGMISPKAAAGLAQAVIARLRVKASGPHALAKSLSGGNLQK
FIVGREIESGPKVLIVAQPTWGVDVGAAAQIHNELLALKATGCALLVVSEELDELFAICD
RLHVIAKGRLSPSIPTRDATREQVGLWMSGLWEGGPGGRREQEEAVHHG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory