Comparing RR42_RS04825 FitnessBrowser__Cup4G11:RR42_RS04825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
34% identity, 94% coverage: 1:366/391 of query aligns to 22:381/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
34% identity, 94% coverage: 1:366/391 of query aligns to 22:381/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
39% identity, 61% coverage: 1:238/391 of query aligns to 22:260/260 of 7ahdC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 78% coverage: 1:306/391 of query aligns to 17:324/378 of P69874
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
40% identity, 58% coverage: 17:242/391 of query aligns to 17:244/375 of 2d62A
1g291 Malk (see paper)
41% identity, 58% coverage: 17:242/391 of query aligns to 14:241/372 of 1g291
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 62% coverage: 2:242/391 of query aligns to 4:236/393 of P9WQI3
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 63% coverage: 1:248/391 of query aligns to 1:235/348 of 3d31A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 62% coverage: 1:241/391 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 62% coverage: 2:242/391 of query aligns to 3:233/384 of 8hplC
8hprC Lpqy-sugabc in state 4 (see paper)
39% identity, 62% coverage: 2:242/391 of query aligns to 3:235/363 of 8hprC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
39% identity, 62% coverage: 2:242/391 of query aligns to 7:230/353 of 1vciA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 62% coverage: 1:241/391 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 62% coverage: 1:241/391 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 62% coverage: 1:241/391 of query aligns to 2:242/344 of 3tuiC
8hprD Lpqy-sugabc in state 4 (see paper)
39% identity, 62% coverage: 2:242/391 of query aligns to 3:235/362 of 8hprD
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 62% coverage: 2:242/391 of query aligns to 3:234/374 of 2awnB
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 62% coverage: 2:242/391 of query aligns to 3:234/371 of 3puyA
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 62% coverage: 2:242/391 of query aligns to 3:234/371 of 3puxA
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 62% coverage: 2:242/391 of query aligns to 3:234/371 of 3puwA
>RR42_RS04825 FitnessBrowser__Cup4G11:RR42_RS04825
MIELDQLTKTFRQKDGAEVRAVDAVSLTVPKGEICVFLGPSGCGKTTTLKMINRLIQPSS
GRVLIDGEDTSRVDEVTLRRKIGYVIQQIGLFPNMTIEENIMVVPRLLGWDKKRSRERAR
ELMSMVQLDPGKMLTRYPRELSGGQQQRIGVIRALAADAPVLLMDEPFGAVDPINRESIQ
NEFFLMQRQLGKTVIMVSHDIDEAIKLGDRVAVFRGGKLVQFDHPDALLARPADDFVQAF
IGHDNTLKRLLLVRAGDAATMAQTCSSGMPLAQAFAIMDEADVRHLPVVDDAQRALGYVT
RRDARAGRGVCADAMRPFMATAAFDEHLRIVLSRMYQHNTSWLPVVDADGVYLGEVTQES
IADYLSSGRSRGNAPVIQPPQAPAAIERNAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory