SitesBLAST
Comparing RR42_RS04830 FitnessBrowser__Cup4G11:RR42_RS04830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
49% identity, 97% coverage: 17:523/525 of query aligns to 1:504/504 of 1eyyA
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
25% identity, 78% coverage: 4:414/525 of query aligns to 6:402/454 of 3ty7B
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
28% identity, 82% coverage: 25:453/525 of query aligns to 48:466/515 of 2d4eC
- active site: N173 (= N158), K196 (= K183), E271 (= E264), C305 (= C301), E409 (= E392)
- binding nicotinamide-adenine-dinucleotide: I169 (≠ F154), T170 (≠ G155), P171 (≠ A156), W172 (≠ S157), K196 (= K183), A198 (≠ H185), G229 (= G220), G233 (= G224), A234 (≠ T225), T248 (= T239), G249 (= G240), E250 (vs. gap), T253 (≠ S243), E271 (= E264), L272 (≠ M265), C305 (= C301), E409 (= E392), F411 (= F394)
Sites not aligning to the query:
3rhdA Crystal structure of glyceraldehyde-3-phosphate dehydrogenase gapn from methanocaldococcus jannaschii dsm 2661 complexed with NADP
24% identity, 77% coverage: 21:424/525 of query aligns to 6:391/456 of 3rhdA
- active site: N133 (= N158), H156 (≠ K183), E233 (= E264), C267 (= C301), E360 (= E392)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I129 (vs. gap), T130 (vs. gap), F132 (≠ S157), H156 (≠ K183), S158 (≠ H185), S159 (= S186), K160 (vs. gap), G193 (= G220), E194 (≠ V221), G197 (= G224), D198 (≠ T225), F211 (= F238), S214 (= S241), V217 (≠ G244)
Sites not aligning to the query:
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
28% identity, 57% coverage: 6:303/525 of query aligns to 7:287/489 of 4cazA
- active site: N152 (= N158), K175 (= K183), E251 (= E264), C285 (= C301)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F154), G149 (= G155), W151 (≠ S157), N152 (= N158), K175 (= K183), E178 (≠ S186), G208 (= G220), G212 (= G224), F226 (= F238), T227 (= T239), G228 (= G240), G229 (≠ S241), T232 (≠ G244), V236 (≠ L248), E251 (= E264), L252 (≠ M265), C285 (= C301)
Sites not aligning to the query:
- active site: 386, 463
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: 386, 388
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
28% identity, 57% coverage: 6:303/525 of query aligns to 7:287/489 of 2woxA
- active site: N152 (= N158), K175 (= K183), E251 (= E264), C285 (= C301)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ F154), G149 (= G155), W151 (≠ S157), N152 (= N158), K175 (= K183), S177 (≠ H185), E178 (≠ S186), G208 (= G220), G212 (= G224), F226 (= F238), T227 (= T239), G228 (= G240), G229 (≠ S241), T232 (≠ G244), V236 (≠ L248), E251 (= E264), L252 (≠ M265), C285 (= C301)
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
28% identity, 57% coverage: 6:303/525 of query aligns to 7:287/489 of 2wmeA
- active site: N152 (= N158), K175 (= K183), E251 (= E264), C285 (= C301)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G155), W151 (≠ S157), K175 (= K183), S177 (≠ H185), E178 (≠ S186), G208 (= G220), G212 (= G224), F226 (= F238), G228 (= G240), G229 (≠ S241), T232 (≠ G244), V236 (≠ L248)
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
28% identity, 57% coverage: 6:303/525 of query aligns to 8:288/490 of Q9HTJ1
- GAWN 150:153 (≠ GASN 155:158) binding
- K162 (≠ D169) active site, Charge relay system
- KPSE 176:179 (≠ KAHS 183:186) binding
- G209 (= G220) binding
- GTST 230:233 (≠ SRSG 241:244) binding
- E252 (= E264) active site, Proton acceptor
- C286 (= C301) binding covalent; modified: Cysteine sulfenic acid (-SOH)
Sites not aligning to the query:
- 387 binding
- 464 active site, Charge relay system
Q9H2A2 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase family 8 member A1; EC 1.2.1.32 from Homo sapiens (Human) (see paper)
26% identity, 78% coverage: 18:426/525 of query aligns to 22:425/487 of Q9H2A2
- R109 (= R105) mutation to A: About 65-fold loss of catalytic efficiency.
- N155 (≠ P160) mutation to A: Complete loss of activity.
Sites not aligning to the query:
- 451 R→A: Complete loss of activity.
6s6wA Crystal structure of human aldh1a3 in complex with 2,6- diphenylimidazo[1,2-a]pyridine (compound ga11) and NAD+ (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 25:436/476 of 6s6wA
- active site: N159 (= N158), E258 (= E264), C292 (= C301)
- binding 2,6-diphenylimidazo[1,2-a]pyridine: E113 (≠ A114), G114 (≠ S115), W167 (≠ G168)
- binding nicotinamide-adenine-dinucleotide: I155 (vs. gap), T156 (vs. gap), W158 (≠ S157), K182 (= K183), A184 (≠ H185), G215 (= G220), G219 (= G224), A220 (≠ T225), F233 (= F238), S236 (= S241), V239 (≠ G244), K338 (≠ A348)
Sites not aligning to the query:
6x9lA Crystal structure of aldehyde dehydrogenasE C (aldc) mutant (c291a) from pseudomonas syringae in complexed with NAD+ and octanal (see paper)
30% identity, 82% coverage: 24:455/525 of query aligns to 32:444/485 of 6x9lA
- active site: N154 (= N158), E252 (= E264), A286 (≠ C301)
- binding nicotinamide-adenine-dinucleotide: I150 (≠ F154), T151 (≠ G155), W153 (≠ S157), N154 (= N158), Q159 (≠ F163), K177 (= K183), E180 (≠ S186), G210 (= G220), P211 (≠ V221), G214 (= G224), T229 (= T239), G230 (= G240), S231 (= S241), E252 (= E264), L253 (≠ M265), A286 (≠ C301), E386 (= E392), F388 (= F394)
- binding octanal: W155 (≠ F159), S285 (≠ F300)
Sites not aligning to the query:
7qk9A Crystal structure of the aldh1a3-atp complex (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 28:449/489 of 7qk9A
- binding adenosine-5'-triphosphate: I158 (vs. gap), T159 (vs. gap), P160 (vs. gap), W161 (≠ S157), K185 (= K183), E188 (≠ S186), G218 (= G220), G222 (= G224), F236 (= F238), S239 (= S241), V242 (≠ G244)
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 29:450/489 of 7a6qB
- active site: N163 (= N158), E262 (= E264), C296 (= C301)
- binding nicotinamide-adenine-dinucleotide: I159 (vs. gap), W162 (≠ S157), K186 (= K183), E189 (≠ S186), G219 (= G220), G223 (= G224), S240 (= S241), V243 (≠ G244), K342 (≠ A342)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (≠ H22), T33 (≠ A23), C34 (≠ T24), P36 (= P26), D103 (≠ L99), E189 (≠ S186), Q190 (≠ A187), F218 (≠ A219), I339 (= I339), D340 (≠ S340)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ S115), D141 (≠ P139), N143 (≠ L141)
Sites not aligning to the query:
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 29:450/489 of 7a6qA
- active site: N163 (= N158), E262 (= E264), C296 (= C301)
- binding nicotinamide-adenine-dinucleotide: I159 (vs. gap), T160 (vs. gap), W162 (≠ S157), K186 (= K183), A188 (≠ H185), E189 (≠ S186), G219 (= G220), G223 (= G224), S240 (= S241), V243 (≠ G244), K342 (≠ A342), K346 (≠ G346)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ S115), D141 (≠ P139), N143 (≠ L141)
Sites not aligning to the query:
5fhzA Human aldehyde dehydrogenase 1a3 complexed with NAD(+) and retinoic acid (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 29:450/489 of 5fhzA
- active site: N163 (= N158), K186 (= K183), E262 (= E264), C296 (= C301), E393 (= E392)
- binding nicotinamide-adenine-dinucleotide: I159 (vs. gap), T160 (vs. gap), W162 (≠ S157), K186 (= K183), E189 (≠ S186), G219 (= G220), G223 (= G224), F237 (= F238), G239 (= G240), S240 (= S241), T241 (≠ R242), V243 (≠ G244), G264 (≠ S266), Q343 (≠ Y343), E393 (= E392)
- binding retinoic acid: G118 (≠ S115), R121 (= R118), F164 (= F159), M168 (≠ F163), W171 (≠ G168), C295 (≠ F300), C296 (= C301)
Sites not aligning to the query:
6te5B Crystal structure of human aldehyde dehydrogenase 1a3 in complex with lq43 inhibitor compound (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 23:439/479 of 6te5B
- active site: N157 (= N158), E256 (= E264), C290 (= C301)
- binding 6-(3,5-dimethoxyphenyl)-2-(4-methoxyphenyl)imidazo[1,2-a]pyridine: E111 (≠ A114), G112 (≠ S115), T116 (≠ D119)
- binding nicotinamide-adenine-dinucleotide: I153 (vs. gap), T154 (vs. gap), W156 (≠ S157), K180 (= K183), E183 (≠ S186), G213 (= G220), F231 (= F238), S234 (= S241), V237 (≠ G244), Q337 (≠ Y343), K340 (≠ G346)
Sites not aligning to the query:
6tryA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with mf13 inhibitor compound (see paper)
26% identity, 83% coverage: 19:453/525 of query aligns to 22:438/478 of 6tryA
- active site: N156 (= N158), E255 (= E264), C289 (= C301)
- binding nicotinamide-adenine-dinucleotide: I152 (vs. gap), T153 (vs. gap), W155 (≠ S157), K179 (= K183), A181 (≠ H185), E182 (≠ S186), G212 (= G220), G216 (= G224), A217 (≠ T225), F230 (= F238), G232 (= G240), S233 (= S241), V236 (≠ G244), K335 (≠ A342)
- binding 8-(4-chlorophenyl)-2-phenyl-imidazo[1,2-a]pyridine: I107 (≠ L110), G111 (≠ S115), T115 (≠ D119), L160 (≠ A162), C288 (≠ F300)
Sites not aligning to the query:
8vr1A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (ctp bound)
28% identity, 77% coverage: 19:424/525 of query aligns to 20:417/488 of 8vr1A
8vr0A Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (gmp bound)
28% identity, 77% coverage: 19:424/525 of query aligns to 20:417/488 of 8vr0A
8vqzA Crystal structure of betaine aldehyde dehydrogenase (betb) from klebsiella aerogenes (cmp bound)
28% identity, 77% coverage: 19:424/525 of query aligns to 20:417/488 of 8vqzA
Query Sequence
>RR42_RS04830 FitnessBrowser__Cup4G11:RR42_RS04830
MTITGEMLIGASAVRGTTKILHATNPATGEVLAPEFHGGGAAEAERACALAEAAFDTYRN
TSPETRARFLESIASGLEALGDTLIERAHAESALPVARLQGERARTAGQLRLFASVLRDG
RWQSATLDSALPERTPPRPDLRLQKIAVGPVAVFGASNFPLAFSVAGGDTASALAAGCPV
VVKAHSAHLGTSELVGRVIQKAVADAGLPEGVFSLLVGAGVAVGTALVAHPSIQAVGFTG
SRSGGLALVQTANSRPQPIPVYAEMSSINPVFLLPAALAARGAQIARNLVDSLVMGVGQF
CTNPGLLLAVESPALDVFRQGAIAALAEKAAATMLTPGISQAYDNGVAQLSDIEGLRRIG
SGQTASGPNQARPALFETTAERFLADHRMEAEVFGPSSVLVVCRDHEEMLAVARRLEGQL
TATVQADAGDRAEAGSLLTVLERKAGRVLFNGYPTGVEVSYAMVHGGPFPATSDTRATSV
GASAIERFLRPVCYQNVPAELLPPALQDGNPLKVWRLTDGQLARD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory