Comparing RR42_RS05130 FitnessBrowser__Cup4G11:RR42_RS05130 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 88% coverage: 6:126/137 of query aligns to 70:181/187 of Q94JQ4
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
33% identity, 59% coverage: 52:132/137 of query aligns to 44:126/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
33% identity, 59% coverage: 52:132/137 of query aligns to 44:126/127 of 2uykC
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
36% identity, 59% coverage: 52:132/137 of query aligns to 44:127/127 of 3vczB
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
34% identity, 66% coverage: 37:126/137 of query aligns to 14:102/108 of 5hp8A
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 59% coverage: 52:132/137 of query aligns to 45:127/128 of Q7CP78
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
32% identity, 59% coverage: 53:133/137 of query aligns to 46:125/126 of 2b33B
Sites not aligning to the query:
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
33% identity, 88% coverage: 11:130/137 of query aligns to 14:124/128 of P0AFQ5
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
28% identity, 91% coverage: 9:132/137 of query aligns to 15:129/137 of P52759
Sites not aligning to the query:
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
30% identity, 91% coverage: 9:132/137 of query aligns to 15:129/137 of P80601
Sites not aligning to the query:
>RR42_RS05130 FitnessBrowser__Cup4G11:RR42_RS05130
MNAPVRQDPPPLARYTASRRAGRHVHVSGMSARTADGCAGVSVAAGGTRVYDIAAQTDCV
LGKIERALASEGMGLADCVAMTCYLIDMADYDTFNAAYARHFPAAVPTRTCLAVAALPHP
DMRVEITATAWRDEEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory