Comparing RR42_RS05495 FitnessBrowser__Cup4G11:RR42_RS05495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
51% identity, 98% coverage: 2:242/245 of query aligns to 2:245/250 of 4y96A
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
48% identity, 99% coverage: 1:242/245 of query aligns to 1:245/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
48% identity, 99% coverage: 1:242/245 of query aligns to 1:245/255 of B1XB85
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
49% identity, 96% coverage: 1:234/245 of query aligns to 1:239/256 of P50921
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
48% identity, 95% coverage: 2:234/245 of query aligns to 1:238/255 of 1aw1A
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
44% identity, 96% coverage: 2:236/245 of query aligns to 402:640/654 of P36204
Sites not aligning to the query:
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
43% identity, 99% coverage: 1:242/245 of query aligns to 1:246/253 of P27876
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
43% identity, 99% coverage: 1:242/245 of query aligns to 1:246/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:242/245 of query aligns to 1:245/251 of 1btmA
6bveA Triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid (see paper)
43% identity, 100% coverage: 1:244/245 of query aligns to 1:239/242 of 6bveA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
42% identity, 99% coverage: 1:242/245 of query aligns to 1:248/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
42% identity, 99% coverage: 1:242/245 of query aligns to 1:248/253 of Q6GIL6
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
42% identity, 99% coverage: 1:242/245 of query aligns to 2:249/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
42% identity, 99% coverage: 1:242/245 of query aligns to 2:249/254 of 3uwwA
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
42% identity, 99% coverage: 1:242/245 of query aligns to 3:250/255 of 3uwvA
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
43% identity, 100% coverage: 2:245/245 of query aligns to 4:250/252 of 6neeB
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
45% identity, 96% coverage: 3:237/245 of query aligns to 4:240/249 of 2y63A
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
45% identity, 96% coverage: 3:237/245 of query aligns to 4:240/249 of 2y61A
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
45% identity, 96% coverage: 3:237/245 of query aligns to 4:240/249 of 2vxnA
1if2A X-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp (see paper)
45% identity, 96% coverage: 3:237/245 of query aligns to 4:240/249 of 1if2A
>RR42_RS05495 FitnessBrowser__Cup4G11:RR42_RS05495
MRQKLVIGNWKMHGSLAANVTLLEAIKAAPASARLAVCAPFPYLAQCQALLAGSAVAWGA
QDVSAEARGAFTGEVAASMLAEFGASYALVGHSERRSYHGETDATVAAKAVRALEFGIVP
VVCVGESLAQREAGETEAVVGRQLGAVLEALSLDQLGRIVLAYEPVWAIGTGKTASSEQA
QAVHAFLRAQVAARDAGVAARMAMLYGGSVKPDNAAELFSMPDIDGGLIGGASLKSDDFL
AIGNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory