SitesBLAST
Comparing RR42_RS05535 FitnessBrowser__Cup4G11:RR42_RS05535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
52% identity, 92% coverage: 25:422/431 of query aligns to 24:426/430 of 7arcF
- binding flavin mononucleotide: G61 (= G60), R62 (= R61), K72 (= K71), N90 (= N88), D92 (= D90), E93 (= E91), S94 (≠ G92), Y178 (= Y176), G181 (= G179), E182 (= E180), T217 (≠ N215), N218 (= N216), L401 (= L397)
- binding iron/sulfur cluster: S352 (= S348), C353 (= C349), G354 (= G350), Q355 (= Q351), C356 (= C352), C359 (= C355), T397 (= T393), C399 (= C395), L401 (= L397)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
52% identity, 90% coverage: 24:412/431 of query aligns to 26:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G60), R61 (= R61), G62 (= G62), K71 (= K71), N89 (= N88), D91 (= D90), Y177 (= Y176), G180 (= G179), E181 (= E180), E182 (= E181), T216 (≠ N215), N217 (= N216)
- binding iron/sulfur cluster: S351 (= S348), C352 (= C349), G353 (= G350), Q354 (= Q351), C355 (= C352), C358 (= C355), T396 (= T393), C398 (= C395), L400 (= L397)
8gymv1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
50% identity, 92% coverage: 28:424/431 of query aligns to 28:431/442 of 8gymv1
- binding flavin mononucleotide: G58 (= G60), G60 (= G62), N88 (= N88), D90 (= D90), Y176 (= Y176), E180 (= E180), E181 (= E181), T215 (≠ N215), N216 (= N216), T219 (= T219), A398 (= A396), L399 (= L397)
- binding iron/sulfur cluster: I177 (= I177), P195 (= P195), C351 (= C349), G352 (= G350), Q353 (= Q351), C354 (= C352), C357 (= C355), T395 (= T393), C397 (= C395), L399 (= L397), G400 (= G398)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
51% identity, 93% coverage: 15:416/431 of query aligns to 20:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G60), K74 (= K71), N91 (= N88), D93 (= D90), Y179 (= Y176), G182 (= G179), E183 (= E180), N218 (= N215), N219 (= N216), L401 (= L397)
- binding iron/sulfur cluster: I180 (= I177), P198 (= P195), S351 (= S348), C352 (= C349), G353 (= G350), K354 (≠ Q351), C355 (= C352), C358 (= C355), F398 (≠ I394), C399 (= C395), L401 (= L397)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
51% identity, 93% coverage: 15:416/431 of query aligns to 20:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G60), G65 (= G62), N91 (= N88), D93 (= D90), G182 (= G179), E183 (= E180), E184 (= E181), N218 (= N215), N219 (= N216), T222 (= T219), P400 (≠ A396)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G62), G66 (= G63), F69 (= F66), K74 (= K71), F77 (= F74), E96 (= E93), Y179 (= Y176), E184 (= E181), K201 (= K198), F204 (= F201), T324 (≠ S321)
- binding iron/sulfur cluster: S351 (= S348), C352 (= C349), K354 (≠ Q351), C355 (= C352), C358 (= C355), F398 (≠ I394), C399 (= C395), L401 (= L397), A402 (≠ G398)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
51% identity, 93% coverage: 15:416/431 of query aligns to 21:421/438 of Q56222
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
47% identity, 98% coverage: 1:422/431 of query aligns to 11:421/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G62), K67 (= K71), N85 (= N88), D87 (= D90), E88 (= E91), G89 (= G92), C175 (= C178), G176 (= G179), A212 (≠ N215), N213 (= N216)
- binding iron/sulfur cluster: S347 (= S348), C348 (= C349), G349 (= G350), C351 (= C352), C354 (= C355), C394 (= C395), L396 (= L397)
- binding : R121 (≠ T124), Y132 (≠ W135), Q139 (≠ E142), R143 (≠ E146), Y146 (≠ R149), E147 (≠ A150), F165 (≠ H168), R168 (≠ H171)
6zk91 Peripheral domain of open complex i during turnover (see paper)
47% identity, 98% coverage: 1:422/431 of query aligns to 14:424/430 of 6zk91
- binding flavin mononucleotide: G59 (= G60), G61 (= G62), K70 (= K71), N88 (= N88), D90 (= D90), E91 (= E91), G179 (= G179), E180 (= E180), A215 (≠ N215), N216 (= N216), A398 (= A396), L399 (= L397)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G62), G62 (= G63), A63 (= A64), F65 (= F66), K70 (= K71), E93 (= E93), Y176 (= Y176), E181 (= E181), F201 (= F201), T323 (≠ S321)
- binding iron/sulfur cluster: I177 (= I177), P195 (= P195), C351 (= C349), G352 (= G350), Q353 (= Q351), C354 (= C352), C357 (= C355), T395 (= T393), C397 (= C395), L399 (= L397)
7v2cA Active state complex i from q10 dataset (see paper)
47% identity, 98% coverage: 1:422/431 of query aligns to 17:427/433 of 7v2cA
- binding flavin mononucleotide: G62 (= G60), K73 (= K71), N91 (= N88), Y179 (= Y176), G182 (= G179), E183 (= E180), N219 (= N216), A401 (= A396), L402 (= L397)
- binding iron/sulfur cluster: P198 (= P195), C354 (= C349), G355 (= G350), Q356 (= Q351), C357 (= C352), C360 (= C355), T398 (= T393), C400 (= C395), L402 (= L397)
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
47% identity, 97% coverage: 1:417/431 of query aligns to 42:447/464 of P25708
- C379 (= C349) binding
- C382 (= C352) binding
- C385 (= C355) binding
- C425 (= C395) binding
5lnk1 Entire ovine respiratory complex i (see paper)
47% identity, 98% coverage: 1:422/431 of query aligns to 16:426/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P94), G97 (= G95)
- binding flavin mononucleotide: G61 (= G60), R62 (= R61), K72 (= K71), N90 (= N88), D92 (= D90), E93 (= E91), G94 (= G92), Y178 (= Y176), G181 (= G179), E182 (= E180), V216 (≠ I214), A217 (≠ N215), N218 (= N216), T221 (= T219), L401 (= L397)
- binding iron/sulfur cluster: P197 (= P195), S352 (= S348), C353 (= C349), Q355 (= Q351), C356 (= C352), C359 (= C355), T397 (= T393), I398 (= I394), C399 (= C395)
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
46% identity, 98% coverage: 1:422/431 of query aligns to 42:452/464 of P49821
- C379 (= C349) binding
- C382 (= C352) binding
- C385 (= C355) binding
- C425 (= C395) binding
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
45% identity, 98% coverage: 1:421/431 of query aligns to 24:433/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G60), G71 (= G62), K80 (= K71), N98 (= N88), D100 (= D90), G189 (= G179), E191 (= E181), N226 (= N216), A408 (= A396), L409 (= L397)
- binding iron/sulfur cluster: P205 (= P195), C361 (= C349), G362 (= G350), Q363 (= Q351), C364 (= C352), C367 (= C355), T405 (= T393), C407 (= C395), L409 (= L397)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
45% identity, 98% coverage: 1:421/431 of query aligns to 22:431/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G60), G69 (= G62), K78 (= K71), N96 (= N88), D98 (= D90), E99 (= E91), G187 (= G179), E188 (= E180), N224 (= N216), A406 (= A396)
- binding iron/sulfur cluster: I185 (= I177), P203 (= P195), C359 (= C349), Q361 (= Q351), C362 (= C352), C365 (= C355), T403 (= T393), I404 (= I394), C405 (= C395), L407 (= L397)
- binding : Y143 (≠ W135), N144 (= N136), Q150 (≠ E142), D174 (≠ Q166)
Q91YT0 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Mus musculus (Mouse) (see 2 papers)
46% identity, 98% coverage: 1:422/431 of query aligns to 42:452/464 of Q91YT0
- C379 (= C349) binding
- C382 (= C352) binding
- C385 (= C355) binding
- C425 (= C395) binding
Sites not aligning to the query:
- 1:20 modified: transit peptide, Mitochondrion
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
45% identity, 96% coverage: 18:431/431 of query aligns to 17:434/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G60), G59 (= G62), K68 (= K71), N89 (= N88), D91 (= D90), E92 (= E91), G180 (= G179), E181 (= E180), E182 (= E181), T216 (≠ N215), N217 (= N216)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G62), G60 (= G63), F63 (= F66), K68 (= K71), E94 (= E93), Y177 (= Y176), E182 (= E181), F202 (= F201), T324 (≠ S321)
- binding iron/sulfur cluster: P196 (= P195), S351 (= S348), C352 (= C349), G353 (= G350), Q354 (= Q351), C355 (= C352), C358 (= C355), T396 (= T393), C398 (= C395), L400 (= L397)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
45% identity, 96% coverage: 18:431/431 of query aligns to 18:435/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G62), K69 (= K71), N90 (= N88), D92 (= D90), E93 (= E91), G94 (= G92), Y178 (= Y176), G181 (= G179), E182 (= E180), N218 (= N216)
- binding iron/sulfur cluster: P197 (= P195), S352 (= S348), C353 (= C349), Q355 (= Q351), C356 (= C352), C359 (= C355), T397 (= T393), C399 (= C395)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
47% identity, 91% coverage: 29:421/431 of query aligns to 30:426/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G60), G61 (= G62), K70 (= K71), N91 (= N88), D93 (= D90), G182 (= G179), E183 (= E180), E184 (= E181), A218 (≠ N215), N219 (= N216), A401 (= A396), L402 (= L397)
- binding iron/sulfur cluster: P198 (= P195), C354 (= C349), G355 (= G350), Q356 (= Q351), C357 (= C352), C360 (= C355), T398 (= T393), C400 (= C395), L402 (= L397)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
48% identity, 93% coverage: 22:421/431 of query aligns to 17:422/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G60), R54 (= R61), G55 (= G62), A57 (= A64), K64 (= K71), N90 (= N88), D92 (= D90), Y178 (= Y176), G181 (= G179), E182 (= E180), E183 (= E181), N217 (= N215), N218 (= N216), S221 (≠ T219), L398 (= L397)
- binding iron/sulfur cluster: P197 (= P195), S349 (= S348), C350 (= C349), G351 (= G350), K352 (≠ Q351), C353 (= C352), C356 (= C355), S394 (≠ T393), F395 (≠ I394), C396 (= C395), L398 (= L397), G399 (= G398)
- binding zinc ion: C333 (= C332), E371 (= E370), H420 (= H419)
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
44% identity, 93% coverage: 26:425/431 of query aligns to 167:564/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G62), N227 (= N88), E230 (= E91), N355 (= N216), G535 (≠ A396), L536 (= L397)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E181), R337 (≠ K198), R340 (≠ F201), T341 (≠ P202), N342 (≠ A203), S433 (= S293)
- binding iron/sulfur cluster: S487 (= S348), C488 (= C349), G489 (= G350), C491 (= C352), C494 (= C355), C534 (= C395), L536 (= L397), G537 (= G398)
- binding zinc ion: C471 (= C332), H558 (= H419), C564 (= C425)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
Query Sequence
>RR42_RS05535 FitnessBrowser__Cup4G11:RR42_RS05535
MTSLHDRHIKPLILAGLDGSNWHLDDYVKRGGYQQLKRILTEKITPEQVIADVKASGLRG
RGGAGFPTGLKWSFMPRQFPGQKYLVCNTDEGEPGTFKDRDIIRYNPHALIEGMAIGAYA
MGITVGYNYIHGEIWNEYKIFEQALEEARAAGFLGDNILGSGFDFQLHAHHGYGAYICGE
ETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETFAAVPFLLSIGPENYLKMGKP
NNGGSKIFSISGDVERPGNYEIPLGTPFATLLELAGGMRGGKRIKAVIPGGSSAPVVPGD
MMMASDMDYDSIAKAGSMLGSGAVIVMDETRCMVRSLLRLSYFYFEESCGQCTPCREGTG
WLYRMVNRIEHGEGRQEDLDLLNNVAENIMGRTICALGDAAAMPVRGMLKHYWKEFEYHV
EHKQCMVPAYS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory