SitesBLAST
Comparing RR42_RS05600 FitnessBrowser__Cup4G11:RR42_RS05600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6af6A Piga with fad and proline (see paper)
28% identity, 90% coverage: 1:336/372 of query aligns to 1:349/383 of 6af6A
- active site: A127 (≠ F121), T128 (≠ N122), A244 (= A229)
- binding flavin-adenine dinucleotide: N125 (≠ T119), A127 (≠ F121), T128 (≠ N122), G133 (≠ R127), S134 (≠ Y128), F158 (≠ V148), I159 (≠ T149), T160 (≠ I150), W211 (≠ A199)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L41 (≠ A37), K44 (≠ S40), K275 (≠ V260), F280 (= F265)
- binding proline: G133 (≠ R127), I136 (≠ L130), F237 (≠ I222), M241 (≠ A226)
Sites not aligning to the query:
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
28% identity, 97% coverage: 1:362/372 of query aligns to 1:354/364 of 6wy8C
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 92% coverage: 1:344/372 of query aligns to 1:355/380 of 4l1fA
- active site: L125 (≠ F121), T126 (≠ N122), G242 (≠ A229)
- binding coenzyme a persulfide: T132 (≠ Y128), H179 (≠ S172), F232 (= F219), M236 (≠ E223), E237 (≠ Q224), L239 (≠ A226), D240 (= D227), R243 (≠ A230)
- binding flavin-adenine dinucleotide: F123 (≠ T119), L125 (≠ F121), T126 (≠ N122), G131 (≠ R127), T132 (≠ Y128), F156 (≠ V148), I157 (≠ T149), T158 (≠ I150), R268 (= R255), Q270 (= Q257), F271 (= F258), I275 (= I262), F278 (= F265), L281 (= L268), Q336 (= Q325), I337 (= I326), G340 (= G329)
- binding 1,3-propandiol: L5 (= L5), Q10 (≠ K10)
Sites not aligning to the query:
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
28% identity, 80% coverage: 50:348/372 of query aligns to 47:360/381 of 8sgsA
- binding coenzyme a: S131 (vs. gap), A133 (= A126), N177 (≠ T171), F231 (= F219), M235 (≠ E223), L238 (≠ A226), I312 (≠ E300)
- binding flavin-adenine dinucleotide: F122 (≠ T119), L124 (≠ F121), S125 (≠ N122), G130 (vs. gap), S131 (vs. gap), W155 (≠ V148), T157 (≠ I150), R267 (= R255), F270 (= F258), L274 (≠ I262), L277 (≠ F265), Q335 (= Q325), I336 (= I326), G338 (= G328), G339 (= G329), I357 (≠ L345), I360 (= I348)
Sites not aligning to the query:
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
28% identity, 80% coverage: 50:348/372 of query aligns to 50:363/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M330), T347 (≠ D334), E348 (= E335)
- binding flavin-adenine dinucleotide: F125 (≠ T119), L127 (≠ F121), S128 (≠ N122), G133 (vs. gap), S134 (vs. gap), W158 (≠ V148), T160 (≠ I150), R270 (= R255), F273 (= F258), L280 (≠ F265), V282 (≠ A267), Q338 (= Q325), I339 (= I326), G342 (= G329), I360 (≠ L345)
Sites not aligning to the query:
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
28% identity, 80% coverage: 50:348/372 of query aligns to 53:366/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ T119), L130 (≠ F121), S131 (≠ N122), G136 (vs. gap), S137 (vs. gap), W161 (≠ V148), T163 (≠ I150), T214 (≠ A199), R273 (= R255), F276 (= F258), L280 (≠ I262), L283 (≠ F265), V285 (≠ A267), Q341 (= Q325), I342 (= I326), G345 (= G329), I363 (≠ L345)
Sites not aligning to the query:
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
28% identity, 80% coverage: 50:348/372 of query aligns to 77:390/412 of P16219
- G90 (= G63) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E77) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 119:124, 30% identical) binding in other chain
- R171 (= R134) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ VTI 148:150) binding in other chain
- A192 (= A155) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G173) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R255) binding
- Q308 (= Q266) binding in other chain
- R325 (= R283) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ G313) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QIHGG 325:329) binding
- R380 (≠ H340) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 394:396 binding in other chain
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 81% coverage: 49:348/372 of query aligns to 76:390/412 of P15651
- 152:161 (vs. 119:124, 30% identical) binding
- S161 (vs. gap) binding
- WIT 185:187 (≠ VTI 148:150) binding
- DMGR 269:272 (≠ DYAA 227:230) binding
- R297 (= R255) binding
- QILGG 365:369 (≠ QIHGG 325:329) binding
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 392 active site, Proton acceptor
- 394:396 binding
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
27% identity, 81% coverage: 49:348/372 of query aligns to 49:363/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (≠ V91), F125 (≠ T119), S134 (vs. gap), F234 (= F219), M238 (≠ E223), Q239 (= Q224), L241 (≠ A226), D242 (= D227), R245 (≠ A230)
- binding flavin-adenine dinucleotide: F125 (≠ T119), L127 (≠ F121), S128 (≠ N122), G133 (vs. gap), S134 (vs. gap), W158 (≠ V148), T160 (≠ I150), R270 (= R255), F273 (= F258), L280 (≠ F265), Q338 (= Q325), I339 (= I326), G342 (= G329), I360 (≠ L345)
Sites not aligning to the query:
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
28% identity, 80% coverage: 50:348/372 of query aligns to 44:350/371 of 2vigB
- active site: L121 (≠ F121), S122 (≠ N122), G231 (≠ A229)
- binding coenzyme a persulfide: S128 (vs. gap), F221 (= F219), M225 (≠ E223), Q226 (= Q224), L228 (≠ A226), D229 (= D227), R232 (≠ A230)
- binding flavin-adenine dinucleotide: L121 (≠ F121), S122 (≠ N122), G127 (vs. gap), S128 (vs. gap), W152 (≠ V148), T154 (≠ I150), R257 (= R255), F260 (= F258), L264 (≠ I262), L267 (≠ F265), Q325 (= Q325), I326 (= I326), G329 (= G329), I347 (≠ L345)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
28% identity, 97% coverage: 4:362/372 of query aligns to 1:351/361 of 6wy9B
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
27% identity, 80% coverage: 47:343/372 of query aligns to 44:353/378 of 5ol2F
- active site: L124 (≠ F121), T125 (≠ N122), G241 (≠ A229)
- binding coenzyme a persulfide: L238 (≠ A226), R242 (≠ A230)
- binding flavin-adenine dinucleotide: F122 (≠ T119), L124 (≠ F121), T125 (≠ N122), P127 (= P124), T131 (≠ Y128), F155 (≠ V148), I156 (= I150), T157 (≠ H151), E198 (≠ R192), R267 (= R255), F270 (= F258), L274 (≠ I262), F277 (= F265), Q335 (= Q325), L336 (≠ I326), G338 (= G328), G339 (= G329)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 93% coverage: 1:347/372 of query aligns to 1:357/379 of 1ukwB
- active site: L124 (≠ F121), S125 (≠ N122), T241 (≠ A229)
- binding cobalt (ii) ion: D145 (≠ G140), H146 (≠ K141)
- binding flavin-adenine dinucleotide: F122 (≠ T119), L124 (≠ F121), S125 (≠ N122), G130 (vs. gap), S131 (≠ A126), W155 (≠ V148), S157 (≠ I150), K200 (≠ I194), L357 (= L347)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
28% identity, 93% coverage: 1:347/372 of query aligns to 1:357/379 of 1ukwA
Sites not aligning to the query:
P51174 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Mus musculus (Mouse) (see paper)
27% identity, 81% coverage: 40:342/372 of query aligns to 86:402/430 of P51174
- K318 (≠ Q256) modified: N6-acetyllysine; mutation to R: Reduces activity by 37%; reduces activity by 80% when associated with R-322.
- K322 (≠ V260) modified: N6-acetyllysine; alternate; mutation to R: Reduces activity by 23%; reduces activity by 80% when associated with R-318.
Sites not aligning to the query:
- 42 modified: N6-acetyllysine; K→R: Reduces activity by 90% when associated with R-318 and R-322.
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
27% identity, 80% coverage: 47:343/372 of query aligns to 44:353/379 of 6fahD
- active site: L124 (≠ F121), T125 (≠ N122), G241 (≠ A229)
- binding flavin-adenine dinucleotide: F122 (≠ T119), L124 (≠ F121), T125 (≠ N122), R152 (= R145), F155 (≠ V148), T157 (≠ I150), E198 (≠ D190), R267 (= R255), Q269 (= Q257), F270 (= F258), I274 (= I262), F277 (= F265), Q335 (= Q325), I336 (= I326), G339 (= G329)
Sites not aligning to the query:
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
28% identity, 79% coverage: 51:343/372 of query aligns to 46:349/374 of 5lnxD
- active site: L122 (≠ F121), T123 (≠ N122), G239 (≠ A229)
- binding flavin-adenine dinucleotide: L122 (≠ F121), T123 (≠ N122), G128 (≠ R127), S129 (≠ Y128), F153 (≠ V148), T155 (≠ I150), R265 (= R255), Q267 (= Q257), F268 (= F258), I272 (= I262), N275 (≠ F265), I278 (≠ L268), Q331 (= Q325), I332 (= I326), G335 (= G329)
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
30% identity, 54% coverage: 142:341/372 of query aligns to 154:357/383 of 1bucA
Sites not aligning to the query:
- active site: 128, 129, 367, 379
- binding acetoacetyl-coenzyme a: 96, 126, 134, 135, 366, 367, 368
- binding flavin-adenine dinucleotide: 126, 128, 129, 134, 135, 366, 369, 371, 375
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
30% identity, 54% coverage: 142:341/372 of query aligns to 154:357/383 of Q06319
Sites not aligning to the query:
- 367 active site, Proton acceptor; E→Q: Loss of activity.
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
27% identity, 86% coverage: 49:368/372 of query aligns to 44:372/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ F121), T123 (≠ N122), F153 (≠ V147), I154 (≠ V148), T155 (= T149), K194 (≠ I194), R261 (= R255), S263 (≠ Q257), Y271 (≠ F265), I274 (≠ L268), Q329 (= Q325), V330 (≠ I326), G332 (= G328), G333 (= G329), T358 (≠ D354), E360 (≠ D356)
Query Sequence
>RR42_RS05600 FitnessBrowser__Cup4G11:RR42_RS05600
MNFNLSDEQKQLADAVHRFIDKDYDFETRKKGIKAEAGHSDAAWGALVELGLTALPVPEA
QGGFSGTPIDMMVVMQELGRGLVVEPYFATVVAAYALKLAGGQDALLEQVAGGELKLATA
FNEPHARYALNDVRVTAKGGKLNGRKVVTIHGAQAGKLVVSARTSGADADTSGISLFLVD
PKAAGVSITDYRTIDNLRAADITFKDAQGELLGTEGAAFALIEQVADYAAVLLCAEAVGV
IDTLNAATLEYAKTRQQFGVPIARFQALQHRMVEMFIHAEQSRSITLLAAAKFDEASPEE
RRRFASAAKARVGQAARSVGQEAVQIHGGMGVTDELPAAHMFKRLTLINTTFGDVDHHLS
RFATQPGFLETA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory