SitesBLAST
Comparing RR42_RS05695 FitnessBrowser__Cup4G11:RR42_RS05695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
36% identity, 93% coverage: 15:330/339 of query aligns to 5:317/319 of A4F2N8
- K53 (= K66) mutation to A: Loss of enzymatic activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
35% identity, 95% coverage: 8:330/339 of query aligns to 13:336/339 of Q7XSN8
- E219 (= E216) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A222) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
33% identity, 94% coverage: 14:331/339 of query aligns to 3:317/318 of 1wtcA
- active site: K52 (= K66), S77 (≠ A91), E203 (= E216), G207 (≠ A220), D209 (≠ A222), G231 (≠ S244), I302 (≠ V316), S303 (≠ C317)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ L31), K47 (≠ I61), M48 (≠ T62), A109 (= A123), A110 (= A124), Y114 (≠ A128)
- binding magnesium ion: E203 (= E216), G207 (≠ A220), D209 (≠ A222)
- binding pyridoxal-5'-phosphate: F51 (= F65), K52 (= K66), N79 (= N93), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), G231 (≠ S244), E276 (= E289), T278 (≠ A291), S303 (≠ C317)
1v71A Crystal structure of s.Pombe serine racemase
33% identity, 94% coverage: 14:331/339 of query aligns to 3:317/318 of 1v71A
- active site: K52 (= K66), S77 (≠ A91), E203 (= E216), G207 (≠ A220), D209 (≠ A222), G231 (≠ S244), I302 (≠ V316), S303 (≠ C317)
- binding magnesium ion: E203 (= E216), G207 (≠ A220), D209 (≠ A222)
- binding pyridoxal-5'-phosphate: F51 (= F65), K52 (= K66), N79 (= N93), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), G231 (≠ S244), E276 (= E289), T278 (≠ A291), S303 (≠ C317), G304 (= G318)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
33% identity, 94% coverage: 14:331/339 of query aligns to 4:318/319 of 2zr8A
- active site: K53 (= K66), S78 (≠ A91), E204 (= E216), G208 (≠ A220), D210 (≠ A222), G232 (≠ S244), I303 (≠ V316), S304 (≠ C317)
- binding magnesium ion: E204 (= E216), G208 (≠ A220), D210 (≠ A222)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F65), K53 (= K66), S77 (= S90), S78 (≠ A91), N80 (= N93), H81 (= H94), P147 (= P159), G179 (= G191), G180 (= G192), G181 (= G193), G182 (= G194), G232 (≠ S244), E277 (= E289), T279 (≠ A291), S304 (≠ C317)
- binding serine: S78 (≠ A91), R129 (≠ F142), D231 (= D243), G232 (≠ S244), A233 (≠ L245), Q234 (≠ G246), T235 (≠ A247)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
33% identity, 94% coverage: 14:331/339 of query aligns to 4:318/319 of 2zpuA
- active site: K53 (= K66), S78 (≠ A91), E204 (= E216), G208 (≠ A220), D210 (≠ A222), G232 (≠ S244), I303 (≠ V316), S304 (≠ C317)
- binding magnesium ion: E204 (= E216), G208 (≠ A220), D210 (≠ A222)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F65), K53 (= K66), S77 (= S90), S78 (≠ A91), N80 (= N93), H81 (= H94), P147 (= P159), G179 (= G191), G180 (= G192), G181 (= G193), G182 (= G194), G232 (≠ S244), E277 (= E289), T279 (≠ A291), S304 (≠ C317)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 94% coverage: 14:331/339 of query aligns to 8:322/323 of O59791
- S82 (≠ A91) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 91% coverage: 15:322/339 of query aligns to 5:308/320 of 6zspAAA
- active site: K53 (= K66), S74 (≠ A91), E200 (= E216), A204 (= A220), D206 (≠ A222), G229 (≠ S244), L302 (≠ V316), S303 (≠ C317)
- binding adenosine-5'-triphosphate: S28 (≠ G41), S29 (≠ A42), I30 (≠ A43), K48 (≠ I61), T49 (= T62), Q79 (≠ M96), Y111 (≠ A128), E266 (≠ R282), R267 (≠ D283), K269 (= K285), N306 (= N320)
- binding magnesium ion: E200 (= E216), A204 (= A220), D206 (≠ A222)
- binding malonate ion: K53 (= K66), S73 (= S90), S74 (≠ A91), N76 (= N93), H77 (= H94), R125 (≠ F142), G229 (≠ S244), S232 (≠ A247)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/320 of 7nbhAAA
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A91), G85 (≠ A95), Q86 (≠ M96), K111 (≠ R121), I115 (≠ C125), Y118 (≠ A128), D235 (= D243), P281 (= P290), N313 (= N320), V314 (≠ L321), D315 (= D322)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/322 of 7nbgAAA
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N83 (= N93), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (≠ S244), V237 (≠ L245), T282 (≠ A291), S310 (≠ C317), G311 (= G318)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A91), G85 (≠ A95), Q86 (≠ M96), I101 (≠ L111), K111 (≠ R121), I115 (≠ C125), Y118 (≠ A128)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/323 of 7nbfAAA
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding magnesium ion: N244 (≠ D252)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N83 (= N93), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (≠ S244), V237 (≠ L245), T282 (≠ A291), S310 (≠ C317), G311 (= G318)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ L31), L22 (≠ E32), T23 (= T33), P24 (= P34), L26 (≠ W36), T27 (= T40), F46 (= F59)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/323 of 7nbdAAA
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y281), L278 (≠ A287), V314 (≠ L321)
- binding magnesium ion: N244 (≠ D252)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N83 (= N93), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (≠ S244), V237 (≠ L245), E280 (= E289), T282 (≠ A291), S310 (≠ C317), G311 (= G318)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/323 of 7nbcCCC
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding biphenyl-4-ylacetic acid: T78 (≠ A88), H79 (≠ A89), H84 (= H94), V148 (= V157), H149 (= H158), P150 (= P159)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N83 (= N93), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (≠ S244), V237 (≠ L245), T282 (≠ A291), S310 (≠ C317), G311 (= G318)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
34% identity, 91% coverage: 15:322/339 of query aligns to 5:315/323 of 7nbcAAA
- active site: K53 (= K66), S81 (≠ A91), E207 (= E216), A211 (= A220), D213 (≠ A222), G236 (≠ S244), L309 (≠ V316), S310 (≠ C317)
- binding calcium ion: E207 (= E216), A211 (= A220), D213 (≠ A222)
- binding magnesium ion: N244 (≠ D252)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N83 (= N93), G182 (= G191), G183 (= G192), G184 (= G193), G185 (= G194), M186 (≠ L195), G236 (≠ S244), V237 (≠ L245), T282 (≠ A291), S310 (≠ C317), G311 (= G318)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 91% coverage: 15:322/339 of query aligns to 6:311/322 of 3l6bA
- active site: K54 (= K66), S77 (≠ A91), E203 (= E216), A207 (= A220), D209 (≠ A222), G232 (≠ S244), T278 (≠ A291), L305 (≠ V316), S306 (≠ C317)
- binding malonate ion: K54 (= K66), S76 (= S90), S77 (≠ A91), N79 (= N93), H80 (= H94), R128 (≠ F142), G232 (≠ S244)
- binding manganese (ii) ion: E203 (= E216), A207 (= A220), D209 (≠ A222)
- binding pyridoxal-5'-phosphate: F53 (= F65), K54 (= K66), N79 (= N93), G178 (= G191), G179 (= G192), G180 (= G193), G181 (= G194), M182 (≠ L195), V233 (≠ L245), E276 (= E289), T278 (≠ A291), S306 (≠ C317), G307 (= G318)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 91% coverage: 15:322/339 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K66), S76 (≠ A91), E202 (= E216), A206 (= A220), D208 (≠ A222), G231 (≠ S244), L304 (≠ V316), S305 (≠ C317)
- binding calcium ion: E202 (= E216), A206 (= A220), D208 (≠ A222)
- binding magnesium ion: N239 (≠ D252)
- binding ortho-xylene: S76 (≠ A91), Q81 (≠ M96), I96 (≠ L111), Y113 (≠ A128)
- binding pyridoxal-5'-phosphate: F52 (= F65), K53 (= K66), N78 (= N93), G177 (= G191), G178 (= G192), G179 (= G193), G180 (= G194), M181 (≠ L195), G231 (≠ S244), V232 (≠ L245), E275 (= E289), T277 (≠ A291), S305 (≠ C317), G306 (= G318)
Sites not aligning to the query:
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
35% identity, 93% coverage: 16:329/339 of query aligns to 9:321/326 of 2gn2A
- active site: K56 (= K66), A81 (= A91), Q207 (≠ E216), V211 (≠ A220), G213 (≠ A222), G235 (≠ S244), I308 (≠ V316), S309 (≠ C317)
- binding cytidine-5'-monophosphate: R51 (≠ I61), T52 (= T62), G53 (= G63), A114 (= A124), D117 (≠ E127), Y118 (≠ A128), N312 (= N320)
5cvcA Structure of maize serine racemase (see paper)
36% identity, 91% coverage: 16:322/339 of query aligns to 5:312/329 of 5cvcA
- active site: K52 (= K66), S77 (≠ A91), E203 (= E216), A207 (= A220), D209 (≠ A222), G231 (≠ S244), V306 (= V316), S307 (≠ C317)
- binding magnesium ion: E203 (= E216), A207 (= A220), D209 (≠ A222)
- binding pyridoxal-5'-phosphate: F51 (= F65), K52 (= K66), N79 (= N93), S178 (≠ G191), G179 (= G192), G180 (= G193), G181 (= G194), L232 (= L245), E275 (= E289), S307 (≠ C317), G308 (= G318)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
34% identity, 86% coverage: 30:322/339 of query aligns to 20:320/514 of P04968
- K62 (= K66) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N93) binding
- GGGGL 188:192 (= GGGGL 191:195) binding
- S315 (≠ C317) binding
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
34% identity, 86% coverage: 30:322/339 of query aligns to 16:316/494 of 1tdjA
- active site: K58 (= K66), A83 (= A91), E209 (= E216), S213 (≠ A220), C215 (≠ A222), G237 (≠ S244), L310 (≠ V316), S311 (≠ C317)
- binding pyridoxal-5'-phosphate: F57 (= F65), K58 (= K66), N85 (= N93), G184 (= G191), G185 (= G192), G186 (= G193), G187 (= G194), G237 (≠ S244), E282 (= E289), S311 (≠ C317), G312 (= G318)
Query Sequence
>RR42_RS05695 FitnessBrowser__Cup4G11:RR42_RS05695
MSDLSDLRAHARYPSLPEIQSTARRLQGKVLETPVWRWQTGAALQLDAGTQVWLKLELFQ
ITGTFKVRGALNSIEHMDASARARGVVAASAGNHAMAVAYAAKVAGVGAKLAMPATASPA
RVAACREAGAEVLLLPDVHAAFAHALQLVADEGRTMVHPYDGPLIAQGTATVGLELMRQV
AGLDAVVVPVGGGGLCGGIAAAVKQINPACRVYGVEPEGADAMNRSFEAGRPQTLERVAT
VADSLGAPYALDYSYGVCRQFVDGMVRVSDEAIRAAMRILYRDMKLATEPATAVSTAALL
GPLRQTLAGKKVALIVCGSNLDAARFAELLAVDEPAGAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory