Comparing RR42_RS06325 FitnessBrowser__Cup4G11:RR42_RS06325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
42% identity, 75% coverage: 1:185/247 of query aligns to 77:261/262 of 1t3dA
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
44% identity, 67% coverage: 8:172/247 of query aligns to 80:243/257 of 1ssqD
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
47% identity, 61% coverage: 5:155/247 of query aligns to 103:252/280 of 7bw9A
1sstA Serine acetyltransferase- complex with coa (see paper)
43% identity, 66% coverage: 8:169/247 of query aligns to 80:233/233 of 1sstA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
42% identity, 68% coverage: 8:175/247 of query aligns to 80:249/258 of 4h7oA
Sites not aligning to the query:
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
43% identity, 64% coverage: 5:161/247 of query aligns to 105:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
43% identity, 64% coverage: 5:161/247 of query aligns to 103:266/267 of 3q1xA
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
40% identity, 68% coverage: 1:169/247 of query aligns to 80:247/272 of 3gvdI
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
41% identity, 67% coverage: 5:169/247 of query aligns to 81:244/250 of 4hzdA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
45% identity, 66% coverage: 8:169/247 of query aligns to 83:243/243 of 4n69A
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
39% identity, 66% coverage: 5:167/247 of query aligns to 82:243/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
39% identity, 66% coverage: 5:167/247 of query aligns to 80:241/243 of 7ra4A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
44% identity, 66% coverage: 8:169/247 of query aligns to 79:233/233 of 4n6bA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
31% identity, 47% coverage: 55:169/247 of query aligns to 62:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
31% identity, 47% coverage: 55:169/247 of query aligns to 62:181/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 47% coverage: 55:169/247 of query aligns to 63:182/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
31% identity, 47% coverage: 55:169/247 of query aligns to 62:181/200 of 1krrA
Sites not aligning to the query:
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 49% coverage: 58:178/247 of query aligns to 25:161/191 of G3XD01
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
33% identity, 50% coverage: 56:178/247 of query aligns to 23:161/191 of 3mqhA
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
33% identity, 50% coverage: 56:178/247 of query aligns to 24:162/192 of 3mqgC
Sites not aligning to the query:
>RR42_RS06325 FitnessBrowser__Cup4G11:RR42_RS06325
MFTRLKEDIDAIMRRDPAARSRLEVLTCYPGFHAVVFHRFAHACWNAGFHWLGRWISHWA
RFFTGIEIHPGAKVGRRVFIDHGMGVVVGETAEIGDDCTIYQGVTLGGTSLYKGVKRHPT
LGANVVVSAGAKVLGGYTIGDGARIGSNAVVLKPVPPGATAVGIPARIILPDAPSGQQGA
KQEFSAYGITPNADDPVSLALKSLIDNAAQQHERLETVMAALDRLGEHLENTPNDRFDAS
ELRKLMK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory