SitesBLAST
Comparing RR42_RS06435 FitnessBrowser__Cup4G11:RR42_RS06435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
52% identity, 98% coverage: 9:473/473 of query aligns to 6:465/465 of 3pm9A
- active site: A149 (= A154), L159 (≠ N164)
- binding flavin-adenine dinucleotide: P69 (= P72), Q70 (= Q73), G71 (= G74), G72 (= G75), N73 (= N76), T74 (= T77), G75 (= G78), L76 (= L79), G79 (= G82), Q80 (≠ A83), L91 (= L96), L133 (= L138), G134 (≠ A139), A135 (= A140), C139 (= C144), T140 (= T145), G142 (= G147), G143 (= G148), S146 (= S151), T147 (= T152), A149 (= A154), G150 (= G155), E200 (= E205), G201 (= G206), I205 (= I210), I206 (= I211), E423 (= E431)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
38% identity, 96% coverage: 22:473/473 of query aligns to 25:464/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R335), T337 (≠ P339), K348 (= K350), Y379 (≠ F383), H381 (= H385), H388 (= H392), H423 (= H432)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), Q76 (= Q73), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ A83), L139 (= L138), G140 (≠ A139), A141 (= A140), C145 (= C144), G149 (= G148), N150 (= N149), A152 (≠ S151), T153 (= T152), G157 (= G156), G207 (= G206), I212 (= I211), E422 (= E431), N459 (= N468)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E431)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
38% identity, 96% coverage: 22:473/473 of query aligns to 25:464/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ A83), L139 (= L138), G140 (≠ A139), A141 (= A140), C145 (= C144), H146 (≠ T145), G148 (= G147), G149 (= G148), N150 (= N149), A152 (≠ S151), T153 (= T152), A155 (= A154), E206 (= E205), G207 (= G206), I211 (= I210), I212 (= I211), E422 (= E431), N459 (= N468)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R335), T337 (≠ P339), K348 (= K350), Y379 (≠ F383), H381 (= H385), H388 (= H392), H423 (= H432)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E431)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
38% identity, 96% coverage: 22:473/473 of query aligns to 25:464/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), G85 (= G82), S86 (≠ A83), L139 (= L138), G140 (≠ A139), A141 (= A140), C145 (= C144), H146 (≠ T145), G149 (= G148), N150 (= N149), A152 (≠ S151), T153 (= T152), A155 (= A154), G157 (= G156), E206 (= E205), G207 (= G206), I211 (= I210), I212 (= I211), E422 (= E431), N459 (= N468)
- binding d-malate: M82 (≠ L79), R333 (= R335), T337 (≠ P339), K348 (= K350), Y379 (≠ F383), H381 (= H385), H388 (= H392), E422 (= E431), H423 (= H432)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E431)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
38% identity, 96% coverage: 22:473/473 of query aligns to 25:464/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R335), T337 (≠ P339), K348 (= K350), Y379 (≠ F383), H381 (= H385), H388 (= H392), N390 (= N394), H423 (= H432)
- binding flavin-adenine dinucleotide: W39 (= W36), P75 (= P72), G77 (= G74), G78 (= G75), N79 (= N76), T80 (= T77), G81 (= G78), M82 (≠ L79), G85 (= G82), S86 (≠ A83), L139 (= L138), G140 (≠ A139), A141 (= A140), C145 (= C144), G149 (= G148), N150 (= N149), A152 (≠ S151), T153 (= T152), A155 (= A154), G157 (= G156), G207 (= G206), I212 (= I211), E422 (= E431), H423 (= H432)
- binding zinc ion: H381 (= H385), H388 (= H392), E422 (= E431)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
38% identity, 96% coverage: 22:473/473 of query aligns to 26:465/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W36), P76 (= P72), G78 (= G74), G79 (= G75), N80 (= N76), T81 (= T77), G82 (= G78), M83 (≠ L79), G86 (= G82), S87 (≠ A83), L140 (= L138), A142 (= A140), C146 (= C144), H147 (≠ T145), G150 (= G148), N151 (= N149), A153 (≠ S151), T154 (= T152), G208 (= G206), I212 (= I210), I213 (= I211), E423 (= E431), N460 (= N468)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
38% identity, 96% coverage: 22:473/473 of query aligns to 78:517/521 of Q8N465
- S109 (≠ A53) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V71) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G75) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V93) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L99) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V118) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P135) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S151) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P177) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G179) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S324) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R335) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ P339) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ N348) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K350) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ L370) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G377) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H385) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G387) to V: slight reduction in catalytic activity
- N439 (= N390) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H392) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N394) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V395) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ V399) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E431) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H432) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G433) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 98% coverage: 10:473/473 of query aligns to 32:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 90% coverage: 47:472/473 of query aligns to 48:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P72), G75 (= G74), S76 (≠ G75), G77 (≠ N76), T78 (= T77), G79 (= G78), L80 (= L79), A83 (≠ G82), C84 (≠ A83), P137 (≠ A139), G138 (≠ A140), E139 (= E141), A142 (≠ C144), T143 (= T145), G146 (= G148), N147 (= N149), S149 (= S151), T150 (= T152), A152 (= A154), G153 (= G155), E203 (= E205), G204 (= G206), I209 (= I211), E422 (= E431), H423 (= H432)
- binding fe (iii) ion: H377 (= H385), H384 (= H392), E422 (= E431)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 90% coverage: 49:473/473 of query aligns to 45:456/459 of P9WIT1
- K354 (≠ D362) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L79), R317 (= R335), W321 (vs. gap), H368 (= H385), H375 (= H392), H413 (= H432)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W321 (vs. gap), Y322 (≠ H337), E412 (= E431), H413 (= H432), N449 (= N468)
- binding manganese (ii) ion: H368 (= H385), H375 (= H392), E412 (= E431)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N468)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H432)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E431)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W323 (vs. gap), E414 (= E431), H415 (= H432), N451 (= N468)
- binding manganese (ii) ion: H370 (= H385), H377 (= H392), E414 (= E431)
- binding pyruvic acid: R319 (= R335), H370 (= H385), H377 (= H392), H415 (= H432)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R335), W322 (vs. gap), H369 (= H385), H376 (= H392), H413 (= H432)
- binding flavin-adenine dinucleotide: E32 (≠ W36), P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W322 (vs. gap), E412 (= E431), H413 (= H432), N449 (= N468)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E431)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R335), W322 (vs. gap), S336 (≠ K350), H369 (= H385), H376 (= H392), H413 (= H432)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), E412 (= E431), N449 (= N468)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E412 (= E431)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R335), W322 (vs. gap), H369 (= H385), H376 (= H392), H414 (= H432)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W322 (vs. gap), E413 (= E431), N450 (= N468)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E431)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H432)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N468)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E431)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N468)
- binding lactic acid: R318 (= R335), H369 (= H385), H376 (= H392), H414 (= H432)
- binding manganese (ii) ion: H369 (= H385), H376 (= H392), E413 (= E431)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), Y324 (≠ H337), H370 (= H385), E414 (= E431), N451 (= N468)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R335), W323 (vs. gap), H415 (= H432)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 98% coverage: 9:473/473 of query aligns to 5:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R335), W323 (vs. gap), H370 (= H385), H415 (= H432)
- binding flavin-adenine dinucleotide: P68 (= P72), G70 (= G74), T71 (≠ G75), G72 (≠ N76), T73 (= T77), G74 (= G78), G78 (= G82), V79 (≠ A83), L90 (= L96), P132 (≠ L138), G133 (≠ A139), A134 (= A140), G140 (= G148), M141 (≠ N149), A143 (≠ S151), T144 (= T152), A146 (= A154), S147 (≠ G155), E200 (= E205), G201 (= G206), I206 (= I211), H370 (= H385), E414 (= E431), N451 (= N468)
Query Sequence
>RR42_RS06435 FitnessBrowser__Cup4G11:RR42_RS06435
MNASHLDSFLALCRAALGEQHVLTDAADQAPYLTDWRKRYTGEAVAVLRPGSAEEVAAAV
HACHAHKLAVVPQGGNTGLCGGATPQADQASVVISLQRLNRVRQVDPLNNTITVEAGVIL
QQLQDTAREHGRLFPLSLAAEGSCTIGGNLSTNAGGTAVLRYGNTRELCLGLEVVTPAGE
IWDGLRGLRKDNTGYDLRDLFIGAEGTLGIITAAVMKLYPLPRARVTALAAVANPRAALA
LLAIAQQRAGAMLTGFELMSERCLSLVTTHYPQLRYPFDRPHPQVVLLELSDNESEDHAR
AIFEALMETAFEAGVVQDAVVAESVQQSRDFWNLREHIPLAQVDDGKNIKHDIAVPISRI
ADFIDTTDALIQQAFPGARMVTFGHLGDGNLHYNVSPPVDESHDTFLGNSEAINLIVHDS
VHAHRGSISAEHGLGQLKREENRRYKSGVELAMMRAIKQALDPQGLMNPGKVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory