SitesBLAST
Comparing RR42_RS07500 FitnessBrowser__Cup4G11:RR42_RS07500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2b5oA Ferredoxin-NADP reductase
36% identity, 67% coverage: 135:411/411 of query aligns to 4:292/292 of 2b5oA
- active site: Y71 (= Y202), S72 (= S203), C250 (= C369), E290 (= E409), Y292 (= Y411)
- binding flavin-adenine dinucleotide: R69 (= R200), L70 (≠ M201), Y71 (= Y202), S72 (= S203), C90 (≠ T221), Y96 (vs. gap), G107 (= G236), V108 (= V237), C109 (≠ A238), S110 (= S239), T150 (= T278), E290 (= E409), Y292 (= Y411)
1gjrA Ferredoxin-NADP+ reductase complexed with NADP+ by cocrystallization (see paper)
36% identity, 67% coverage: 135:411/411 of query aligns to 4:295/295 of 1gjrA
- active site: Y71 (= Y202), S72 (= S203), C253 (= C369), E293 (= E409), Y295 (= Y411)
- binding flavin-adenine dinucleotide: R69 (= R200), L70 (≠ M201), Y71 (= Y202), S72 (= S203), C90 (≠ T221), L94 (≠ V225), Y96 (≠ Q227), G107 (= G236), V108 (= V237), C109 (≠ A238), S110 (= S239), T149 (= T278), E293 (= E409), Y295 (= Y411)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R92 (≠ K223), L94 (≠ V225), T147 (= T276), G148 (= G277), T149 (= T278), P186 (≠ R308), S215 (= S334), R216 (= R335), R225 (= R341), Y227 (= Y343), Q229 (= Q345), G254 (= G370), L255 (= L371), Y295 (= Y411)
1queA X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms (see paper)
36% identity, 67% coverage: 135:411/411 of query aligns to 12:303/303 of 1queA
- active site: Y79 (= Y202), S80 (= S203), C261 (= C369), E301 (= E409), Y303 (= Y411)
- binding flavin-adenine dinucleotide: R77 (= R200), L78 (≠ M201), Y79 (= Y202), S80 (= S203), C98 (≠ T221), L102 (≠ V225), Y104 (≠ Q227), K105 (≠ D228), G115 (= G236), V116 (= V237), C117 (≠ A238), S118 (= S239), T157 (= T278), E301 (= E409), Y303 (= Y411)
- binding sulfate ion: S223 (= S334), R224 (= R335), R233 (= R341), Y235 (= Y343)
1ewyA Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
36% identity, 67% coverage: 135:411/411 of query aligns to 12:303/303 of 1ewyA
- active site: Y79 (= Y202), S80 (= S203), C261 (= C369), E301 (= E409), Y303 (= Y411)
- binding flavin-adenine dinucleotide: R77 (= R200), L78 (≠ M201), Y79 (= Y202), S80 (= S203), C98 (≠ T221), L102 (≠ V225), Y104 (≠ Q227), G115 (= G236), V116 (= V237), C117 (≠ A238), S118 (= S239), E301 (= E409), Y303 (= Y411)
1gawB Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf (see paper)
34% identity, 67% coverage: 135:411/411 of query aligns to 20:305/305 of 1gawB
- active site: Y86 (= Y202), S87 (= S203), C263 (= C369), E303 (= E409), Y305 (= Y411)
- binding flavin-adenine dinucleotide: R84 (= R200), L85 (≠ M201), Y86 (= Y202), S87 (= S203), C105 (≠ T221), Y111 (≠ E226), G121 (= G236), V122 (= V237), C123 (≠ A238), S124 (= S239), T163 (= T278), Y305 (= Y411)
2vzlA Ferredoxin-NADP reductase (mutations: t155g, a160t, l263p and y303s) complexed with NAD by cocrystallization (see paper)
35% identity, 67% coverage: 135:410/411 of query aligns to 4:294/295 of 2vzlA
- active site: Y71 (= Y202), S72 (= S203), C253 (= C369), E293 (= E409)
- binding flavin-adenine dinucleotide: R69 (= R200), L70 (≠ M201), Y71 (= Y202), S72 (= S203), C90 (≠ T221), L94 (≠ V225), Y96 (≠ Q227), G107 (= G236), V108 (= V237), C109 (≠ A238), S110 (= S239), T149 (= T278), E293 (= E409)
- binding nicotinamide-adenine-dinucleotide: S72 (= S203), R92 (≠ K223), T149 (= T278), C253 (= C369), G254 (= G370), P255 (≠ L371), E293 (= E409)
Sites not aligning to the query:
3mhpA Fnr-recruitment to the thylakoid (see paper)
36% identity, 67% coverage: 135:411/411 of query aligns to 10:295/296 of 3mhpA
- active site: Y76 (= Y202), S77 (= S203), C253 (= C369), E293 (= E409), Y295 (= Y411)
- binding flavin-adenine dinucleotide: R74 (= R200), L75 (≠ M201), Y76 (= Y202), S77 (= S203), C95 (≠ T221), L99 (vs. gap), G111 (= G236), V112 (= V237), C113 (≠ A238), S114 (= S239), T153 (= T278), E293 (= E409), Y295 (= Y411)
- binding : L25 (≠ G150), T27 (≠ Y152), K28 (≠ R153), I29 (≠ L154), H40 (= H165), F86 (≠ R212), G87 (≠ P213), W163 (≠ E288), F167 (vs. gap), E168 (vs. gap), K169 (≠ R291), E171 (≠ N293), S188 (≠ A310), S189 (≠ R311), E195 (vs. gap), E196 (vs. gap), K199 (≠ P318), K203 (≠ L322)
P10933 Ferredoxin--NADP reductase, leaf isozyme, chloroplastic; FNR; EC 1.18.1.2 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
36% identity, 67% coverage: 135:411/411 of query aligns to 75:360/360 of P10933
- RLYS 139:142 (≠ RMYS 200:203) binding
- S142 (= S203) binding
- CVK 160:162 (≠ TVK 221:223) binding
- K162 (= K223) binding
- Y166 (≠ E226) binding
- VCS 177:179 (≠ VAS 237:239) binding
- T218 (= T278) binding
- VP 250:251 (≠ AR 307:308) binding
- SR 280:281 (= SR 334:335) binding
- K290 (≠ R341) binding
- GL 319:320 (= GL 370:371) binding
- E358 (= E409) binding
- Y360 (= Y411) mutation to F: Results in a 2.0-fold reduction in kcat for the diaphorase reaction.; mutation to G: Results in a 302-fold reduction in kcat for the diaphorase reaction.; mutation to S: Results in a 22-fold reduction in kcat for the diaphorase reaction.; mutation to W: Results in a 2.2-fold reduction in kcat for the diaphorase reaction.
3vo2A Crystal structure of zea mays leaf ferredoxin-NADP+ reductase iii (see paper)
35% identity, 67% coverage: 135:411/411 of query aligns to 11:296/296 of 3vo2A
- active site: Y77 (= Y202), S78 (= S203), C254 (= C369), E294 (= E409), Y296 (= Y411)
- binding flavin-adenine dinucleotide: R75 (= R200), L76 (≠ M201), Y77 (= Y202), S78 (= S203), C96 (≠ T221), V97 (= V222), L100 (vs. gap), Y102 (≠ E226), G112 (= G236), V113 (= V237), C114 (≠ A238), S115 (= S239), T154 (= T278), E294 (= E409), Y296 (= Y411)
1qgaA Pea fnr y308w mutant in complex with NADP+ (see paper)
36% identity, 67% coverage: 135:411/411 of query aligns to 23:308/308 of 1qgaA
- active site: Y89 (= Y202), S90 (= S203), C266 (= C369), E306 (= E409), W308 (≠ Y411)
- binding flavin-adenine dinucleotide: R87 (= R200), L88 (≠ M201), Y89 (= Y202), S90 (= S203), C108 (≠ T221), L112 (vs. gap), Y114 (≠ E226), G124 (= G236), V125 (= V237), C126 (≠ A238), S127 (= S239), T166 (= T278), W308 (≠ Y411)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S203), K110 (= K223), G165 (= G277), T166 (= T278), G167 (= G279), V198 (≠ A307), P199 (≠ R308), S228 (= S334), R229 (= R335), K238 (≠ R341), Y240 (= Y343), Q242 (= Q345), C266 (= C369), G267 (= G370), L268 (= L371), E306 (= E409), W308 (≠ Y411)
1qfzA Pea fnr y308s mutant in complex with NADPH (see paper)
36% identity, 67% coverage: 135:410/411 of query aligns to 23:307/308 of 1qfzA
- active site: Y89 (= Y202), S90 (= S203), C266 (= C369), E306 (= E409)
- binding flavin-adenine dinucleotide: R87 (= R200), L88 (≠ M201), Y89 (= Y202), S90 (= S203), C108 (≠ T221), K110 (= K223), L112 (vs. gap), Y114 (≠ E226), G124 (= G236), V125 (= V237), C126 (≠ A238), S127 (= S239), T166 (= T278)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (= S203), K110 (= K223), G165 (= G277), T166 (= T278), G167 (= G279), V198 (≠ A307), P199 (≠ R308), S228 (= S334), R229 (= R335), Y240 (= Y343), C266 (= C369), G267 (= G370), L268 (= L371), G270 (= G373), E306 (= E409)
Sites not aligning to the query:
1qfyA Pea fnr y308s mutant in complex with NADP+ (see paper)
36% identity, 67% coverage: 135:410/411 of query aligns to 23:307/308 of 1qfyA
- active site: Y89 (= Y202), S90 (= S203), C266 (= C369), E306 (= E409)
- binding flavin-adenine dinucleotide: R87 (= R200), L88 (≠ M201), Y89 (= Y202), S90 (= S203), C108 (≠ T221), L112 (vs. gap), Y114 (≠ E226), G124 (= G236), V125 (= V237), C126 (≠ A238), S127 (= S239), T166 (= T278)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S203), K110 (= K223), G165 (= G277), T166 (= T278), G167 (= G279), V198 (≠ A307), P199 (≠ R308), S228 (= S334), R229 (= R335), K238 (≠ R341), Y240 (= Y343), Q242 (= Q345), C266 (= C369), G267 (= G370), L268 (= L371), G270 (= G373), M271 (= M374), E306 (= E409)
Sites not aligning to the query:
1fncA Refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states (see paper)
33% identity, 67% coverage: 135:411/411 of query aligns to 11:296/296 of 1fncA
- active site: Y77 (= Y202), S78 (= S203), C254 (= C369), E294 (= E409), Y296 (= Y411)
- binding adenosine-2'-5'-diphosphate: K98 (= K223), V186 (≠ A307), P187 (≠ R308), S216 (= S334), R217 (= R335), K226 (≠ R341), Y228 (= Y343), L256 (= L371), G258 (= G373)
- binding dihydroflavine-adenine dinucleotide: R75 (= R200), L76 (≠ M201), Y77 (= Y202), S78 (= S203), C96 (≠ T221), L100 (vs. gap), Y102 (≠ E226), G112 (= G236), V113 (= V237), C114 (≠ A238), S115 (= S239), T154 (= T278), E294 (= E409), Y296 (= Y411)
P00455 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Spinacia oleracea (Spinach) (see 3 papers)
33% identity, 67% coverage: 135:411/411 of query aligns to 84:369/369 of P00455
- RLYS 148:151 (≠ RMYS 200:203) binding
- CVK 169:171 (≠ TVK 221:223) binding
- Y175 (≠ E226) binding
- VCS 186:188 (≠ VAS 237:239) binding
- T227 (= T278) binding
- E367 (= E409) mutation to A: Slightly reduced activity.; mutation E->D,Q: Reduced activity.; mutation to L: Reduces activity by 99%.
Sites not aligning to the query:
- 1:55 modified: transit peptide, Chloroplast
1bx0A Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l (see paper)
32% identity, 67% coverage: 135:411/411 of query aligns to 11:296/296 of 1bx0A
- active site: Y77 (= Y202), S78 (= S203), C254 (= C369), L294 (≠ E409), Y296 (= Y411)
- binding flavin-adenine dinucleotide: R75 (= R200), L76 (≠ M201), Y77 (= Y202), S78 (= S203), C96 (≠ T221), Y102 (≠ E226), G112 (= G236), V113 (= V237), C114 (≠ A238), S115 (= S239), T154 (= T278), Y296 (= Y411)
5h59A Ferredoxin-NADP+ reductase from maize root (see paper)
34% identity, 69% coverage: 129:411/411 of query aligns to 14:311/311 of 5h59A
- active site: Y88 (= Y202), S89 (= S203), F268 (≠ I368), C269 (= C369), E309 (= E409), Y311 (= Y411)
- binding flavin-adenine dinucleotide: R86 (= R200), L87 (≠ M201), Y88 (= Y202), S89 (= S203), C107 (≠ T221), Y113 (vs. gap), K125 (≠ V234), G127 (= G236), V128 (= V237), C129 (≠ A238), S130 (= S239), T170 (= T278), Y311 (= Y411)
5vw4A Nicotinamide soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 69% coverage: 129:410/411 of query aligns to 12:308/309 of 5vw4A
- active site: Y86 (= Y202), S87 (= S203), F266 (≠ I368), C267 (= C369), E307 (= E409)
- binding flavin-adenine dinucleotide: R84 (= R200), L85 (≠ M201), Y86 (= Y202), S87 (= S203), C105 (≠ T221), A109 (≠ V225), Y111 (vs. gap), K123 (≠ V234), G125 (= G236), V126 (= V237), C127 (≠ A238), S128 (= S239), T168 (= T278)
- binding nicotinamide: S87 (= S203), T168 (= T278), G169 (= G279), C267 (= C369), G268 (= G370), E307 (= E409), V308 (≠ T410)
Sites not aligning to the query:
5vw2A NADPH soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 69% coverage: 129:410/411 of query aligns to 12:308/309 of 5vw2A
- active site: Y86 (= Y202), S87 (= S203), F266 (≠ I368), C267 (= C369), E307 (= E409)
- binding dihydroflavine-adenine dinucleotide: R84 (= R200), L85 (≠ M201), Y86 (= Y202), S87 (= S203), C105 (≠ T221), A109 (≠ V225), Y111 (vs. gap), K123 (≠ V234), G125 (= G236), V126 (= V237), C127 (≠ A238), S128 (= S239), T168 (= T278)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S87 (= S203), R107 (≠ K223), T166 (= T276), G167 (= G277), T168 (= T278), G169 (= G279), G199 (= G306), V200 (≠ A307), A201 (≠ R308), S230 (= S334), R231 (= R335), K240 (≠ R341), Y242 (= Y343), Q244 (= Q345), G268 (= G370), L269 (= L371), G271 (= G373), M272 (= M374), E307 (= E409), V308 (≠ T410)
Sites not aligning to the query:
P53991 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Chlamydomonas reinhardtii (Chlamydomonas smithii)
31% identity, 72% coverage: 116:411/411 of query aligns to 45:354/354 of P53991
- K118 (≠ D191) modified: N6,N6,N6-trimethyllysine
- K124 (≠ H197) modified: N6,N6,N6-trimethyllysine
- K170 (≠ R235) modified: N6,N6-dimethyllysine
Sites not aligning to the query:
- 1:35 modified: transit peptide, Chloroplast
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
32% identity, 68% coverage: 133:411/411 of query aligns to 5:306/306 of 2rc6A
- active site: Y90 (= Y202), S91 (= S203), C264 (= C369), E304 (= E409), Y306 (= Y411)
- binding flavin-adenine dinucleotide: R88 (= R200), L89 (≠ M201), Y90 (= Y202), S91 (= S203), I109 (≠ T221), I110 (≠ V222), D113 (≠ V225), I115 (≠ Q227), F122 (≠ V234), G124 (= G236), V125 (= V237), C126 (≠ A238), S127 (= S239), T167 (= T278), E304 (= E409), Y306 (= Y411)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K111 (= K223), T165 (= T276), G166 (= G277), A197 (= A307), P198 (≠ R308), S226 (= S334), R227 (= R335), R237 (= R341), Y239 (= Y343), P267 (vs. gap), M270 (= M374)
- binding zinc ion: E181 (≠ R291), H216 (≠ F326)
Query Sequence
>RR42_RS07500 FitnessBrowser__Cup4G11:RR42_RS07500
MGAPDIIKQHLIDPEICIRCNTCEDTCPIDAITHDDRNYVVRADVCNGCGACLGPCPTGA
IDNWRTMLKSEAYPIEAQLLWDELPASLPLPADAGIDDAPDTASPQTGQEPQTQQVETSR
HTSPKAPWSAAHPYVNLHGVRAPVTATVAGNYRLTADDASSDVHHIVLDFGQHFFPVLEG
QAIGIVPPGTDANGKPHYIRMYSIASPRDGERPGYNNLALTVKRVEQDHEGQPVRGVASN
FLCDLARGDEVRVVGPFGTTFLMPNHREASVMMICTGTGSAPMRAMTEHMRRNVGQFDGQ
RLLFFGARNARELPYFGPLMKLPPSFLDIHLAFSRDPGQPRRYVQDAIREAGARVAALLN
DPHGHVYICGLKGMEDGVLAAFAEVCAGAGLAWGELEAAMKTEGRLHIETY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory