Comparing RR42_RS07510 FitnessBrowser__Cup4G11:RR42_RS07510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
34% identity, 34% coverage: 61:250/566 of query aligns to 24:202/259 of 5zaiC
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
26% identity, 48% coverage: 72:340/566 of query aligns to 67:343/763 of P40939
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
33% identity, 34% coverage: 41:230/566 of query aligns to 13:186/707 of 6yswA
Sites not aligning to the query:
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
38% identity, 22% coverage: 72:194/566 of query aligns to 36:150/261 of 5jbxB
Sites not aligning to the query:
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
34% identity, 28% coverage: 72:230/566 of query aligns to 39:189/715 of 1wdlA
Sites not aligning to the query:
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
34% identity, 28% coverage: 72:230/566 of query aligns to 39:189/715 of P28793
Sites not aligning to the query:
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
30% identity, 33% coverage: 62:250/566 of query aligns to 28:203/260 of 2hw5C
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 28% coverage: 72:230/566 of query aligns to 39:189/707 of 1wdmA
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
29% identity, 33% coverage: 62:250/566 of query aligns to 28:201/258 of 1mj3A
Sites not aligning to the query:
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 33% coverage: 62:250/566 of query aligns to 27:197/254 of 2dubA
Sites not aligning to the query:
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
30% identity, 33% coverage: 62:250/566 of query aligns to 28:203/260 of 1dubA
Sites not aligning to the query:
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
30% identity, 33% coverage: 62:250/566 of query aligns to 26:201/258 of 1ey3A
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 33% coverage: 62:250/566 of query aligns to 58:233/290 of P14604
Sites not aligning to the query:
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
29% identity, 34% coverage: 43:237/566 of query aligns to 7:195/729 of P21177
Sites not aligning to the query:
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
29% identity, 34% coverage: 43:237/566 of query aligns to 7:195/719 of 6tnmA
Sites not aligning to the query:
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
30% identity, 26% coverage: 84:231/566 of query aligns to 53:190/270 of Q4WF54
Sites not aligning to the query:
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
30% identity, 27% coverage: 87:239/566 of query aligns to 44:188/692 of 6iunB
Sites not aligning to the query:
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
49% identity, 9% coverage: 143:195/566 of query aligns to 97:146/256 of 3h81A
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
49% identity, 9% coverage: 143:195/566 of query aligns to 93:142/250 of 3q0gD
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
49% identity, 9% coverage: 143:195/566 of query aligns to 98:147/255 of 3q0jC
Sites not aligning to the query:
>RR42_RS07510 FitnessBrowser__Cup4G11:RR42_RS07510
MSAPATSTATTATATTEQAPVTFERDPAQYRHWKLTFAGPVATLSMDIDEDGGLRPGYAL
KLNSYDLGVDIELHDAVQRIRFEHPEVRTVILTSAKDRIFCSGANIFMLGKSSHAWKVNF
CKFTNETRNGIEDASRHSGLKFIAACNGTTAGGGYELALACDEIVLVDDRSSAVSLPEVP
LLGVLPGTGGLTRLTDKRRVRRDHADIFCTTTEGVRGQRAHDWKLVDAVVKPARFAEHVQ
QRALALAAQSDRPAGHDGVKLTPLSRSQEAHGYRYDTVQVHIDPRARKATLTVFGPAKHQ
PQALAAILAAGADWWPLKMARELDDAILTLRANHLDIGIWILKTEGDPHQVLATDALLDA
HASHWFVRETIGMLRRTLARLEVSSRTLFALIEPDSCFAGTLLELALAADRSYMLHLPDA
PDDAPRVFASTANFGRYPAVNGLTRLAARFCQDEVAIQAVQDHIGAPLDAINAASLGLVT
ATPDDIDWEDEIRIAIEERASLSPDALTGLEANLRFGPVETMETRIFGRLTAWQNWIFNR
PNAVGEQGALKVFGSGNKARFDWDRV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory