SitesBLAST
Comparing RR42_RS07655 FitnessBrowser__Cup4G11:RR42_RS07655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8u99A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-serine adduct)
41% identity, 93% coverage: 18:382/392 of query aligns to 19:383/391 of 8u99A
- binding pyridoxal-5'-phosphate: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), T205 (= T201), K206 (= K202), M215 (≠ L211), W336 (= W333)
- binding serine: Y107 (= Y105), K206 (= K202), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
8u98A Crystal structure of cystathionine beta lyase from klebsiella aerogenes (plp-glycine adduct)
41% identity, 93% coverage: 18:382/392 of query aligns to 19:383/391 of 8u98A
- binding glycine: Y107 (= Y105), K206 (= K202), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
- binding pyridoxal-5'-phosphate: Y52 (= Y50), R54 (≠ L52), C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), W336 (= W333)
8sa9A Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp-oxamate adduct (c2 form)
41% identity, 93% coverage: 18:382/392 of query aligns to 19:383/391 of 8sa9A
- binding pyridoxal-5'-phosphate: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), W336 (= W333)
- binding [({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino](oxo)acetic acid: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), S335 (= S332), W336 (= W333), R368 (= R367)
8sabA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp adduct with alanine (c2 form)
41% identity, 93% coverage: 18:382/392 of query aligns to 20:384/392 of 8sabA
- binding lysine: L330 (= L326), E341 (≠ H337)
- binding pyridoxal-5'-phosphate: C82 (≠ S79), G83 (= G80), A84 (≠ L81), Y108 (= Y105), D182 (= D177), A204 (= A199), T206 (= T201), K207 (= K202), M216 (≠ L211), W337 (= W333)
- binding alanyl-pyridoxal-5'-phosphate: C82 (≠ S79), G83 (= G80), A84 (≠ L81), Y108 (= Y105), D182 (= D177), A204 (= A199), T206 (= T201), K207 (= K202), M216 (≠ L211), Y335 (≠ W331), S336 (= S332), W337 (= W333), R369 (= R367)
Sites not aligning to the query:
8sadA Crystal structure of cystathionine beta lyase from klebsiella aerogenes, plp/malonate complex (c2 form)
41% identity, 93% coverage: 18:382/392 of query aligns to 26:390/398 of 8sadA
- binding magnesium ion: A359 (≠ Q346), R362 (= R349), A365 (≠ G352)
- binding pyridoxal-5'-phosphate: C88 (≠ S79), G89 (= G80), A90 (≠ L81), Y114 (= Y105), D188 (= D177), A210 (= A199), T212 (= T201), K213 (= K202), M222 (≠ L211), W343 (= W333)
P06721 Cystathionine beta-lyase MetC; CBL; CL; Beta-cystathionase MetC; Cysteine desulfhydrase MetC; CD; Cysteine lyase MetC; Cysteine-S-conjugate beta-lyase MetC; EC 4.4.1.13; EC 4.4.1.28 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 92% coverage: 24:382/392 of query aligns to 29:387/395 of P06721
- K210 (= K202) modified: N6-(pyridoxal phosphate)lysine
2gqnA Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-nitro-benzamide (see paper)
39% identity, 92% coverage: 24:382/392 of query aligns to 25:383/391 of 2gqnA
- active site: R54 (≠ L52), Y107 (= Y105), D181 (= D177), K206 (= K202)
- binding (5-hydroxy-6-methyl-4-((2-(2-(2-nitrobenzamido)acetyl)hydrazinyl)methyl)pyridin-3-yl)methyl dihydrogen phosphate: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), E108 (≠ G106), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
2fq6A Cystathionine beta-lyase (cbl) from escherichia coli in complex with n-hydrazinocarbonylmethyl-2-trifluoromethyl-benzamide (see paper)
39% identity, 92% coverage: 24:382/392 of query aligns to 25:383/391 of 2fq6A
- active site: R54 (≠ L52), Y107 (= Y105), D181 (= D177), K206 (= K202)
- binding phosphoric acid mono-(5-hydroxy-6-methyl-4-{[2-(2-trifluoromethyl-benzoylamino)-acetyl]-hydrazonomethyl}-pyridin-3-ylmethyl)ester: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), P109 (= P107), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
1cl2A Cystathionine beta-lyase (cbl) from escherichia coli in complex with aminoethoxyvinylglycine (see paper)
39% identity, 92% coverage: 24:382/392 of query aligns to 25:383/391 of 1cl2A
- active site: R54 (≠ L52), Y107 (= Y105), D181 (= D177), K206 (= K202)
- binding (2E,3E)-4-(2-aminoethoxy)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)imino]but-3-enoic acid: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
1cl1B Cystathionine beta-lyase (cbl) from escherichia coli (see paper)
39% identity, 92% coverage: 24:382/392 of query aligns to 26:384/392 of 1cl1B
4itxA P113s mutant of e. Coli cystathionine beta-lyase metc inhibited by reaction with l-ala-p (see paper)
39% identity, 92% coverage: 24:382/392 of query aligns to 25:383/391 of 4itxA
- active site: R54 (≠ L52), Y107 (= Y105), D181 (= D177), K206 (= K202)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: C81 (≠ S79), G82 (= G80), A83 (≠ L81), Y107 (= Y105), D181 (= D177), A203 (= A199), T205 (= T201), K206 (= K202), M215 (≠ L211), Y334 (≠ W331), S335 (= S332), W336 (= W333), R368 (= R367)
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
32% identity, 96% coverage: 14:388/392 of query aligns to 4:387/390 of 8j6nA
- binding [6-methyl-4-[(~{E})-(oxamoylhydrazinylidene)methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: Y51 (= Y50), R53 (≠ L52), G81 (= G80), L82 (= L81), Y105 (= Y105), E148 (= E148), N152 (≠ S152), D178 (= D177), S200 (≠ A199), T202 (= T201), K203 (= K202), E330 (≠ W331), S331 (= S332), T346 (≠ V345), R366 (= R367)
5tsuA Active conformation for engineered human cystathionine gamma lyase (e59n, r119l, e339v) to depleting methionine (see paper)
31% identity, 91% coverage: 14:371/392 of query aligns to 4:363/384 of 5tsuA
6nbaA Crystal structure of human cystathionine gamma lyase with s-3- carboxpropyl-l-cysteine (see paper)
32% identity, 76% coverage: 43:340/392 of query aligns to 44:339/389 of 6nbaA
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: Y51 (= Y50), R53 (≠ L52), G81 (= G80), L82 (= L81), Y105 (= Y105), E148 (= E148), N152 (≠ S152), D178 (= D177), S200 (≠ A199), K203 (= K202), S331 (= S332)
Sites not aligning to the query:
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
33% identity, 86% coverage: 48:386/392 of query aligns to 36:370/373 of 4l0oH
- active site: R40 (≠ L52), Y92 (= Y105), D164 (= D177), K189 (= K202)
- binding pyridoxal-5'-phosphate: Y38 (= Y50), R40 (≠ L52), S67 (= S79), G68 (= G80), L69 (= L81), Y92 (= Y105), D164 (= D177), S186 (≠ A199), T188 (= T201), K189 (= K202)
3cogD Crystal structure of human cystathionase (cystathionine gamma lyase) in complex with dl-propargylglycine (see paper)
32% identity, 76% coverage: 43:340/392 of query aligns to 44:339/392 of 3cogD
- active site: R53 (≠ L52), Y105 (= Y105), D178 (= D177), K203 (= K202)
- binding (2S)-2-aminopent-4-enoic acid: Y51 (= Y50), R53 (≠ L52), Y105 (= Y105), R110 (≠ E110), E330 (≠ W331)
- binding pyridoxal-5'-phosphate: Y51 (= Y50), R53 (≠ L52), G81 (= G80), L82 (= L81), Y105 (= Y105), D178 (= D177), S200 (≠ A199), T202 (= T201), K203 (= K202)
P32929 Cystathionine gamma-lyase; CGL; CSE; Cysteine desulfhydrase; Cysteine-protein sulfhydrase; Gamma-cystathionase; Homocysteine desulfhydrase; EC 4.4.1.1; EC 4.4.1.2 from Homo sapiens (Human) (see 5 papers)
32% identity, 76% coverage: 43:340/392 of query aligns to 53:348/405 of P32929
- T67 (= T57) to I: in CSTNU; reduces catalytic activity and affinity for pyridoxal phosphate; dbSNP:rs28941785
- K212 (= K202) modified: N6-(pyridoxal phosphate)lysine
- Q240 (≠ R230) to E: in CSTNU; strongly reduces catalytic activity and affinity for pyridoxal phosphate; dbSNP:rs28941786
Sites not aligning to the query:
- 403 S → I: in dbSNP:rs1021737
5eigC Engineered human cystathionine gamma lyase (e59t, e339v) to deplet cysteine
33% identity, 75% coverage: 46:340/392 of query aligns to 48:337/388 of 5eigC
5tsuC Active conformation for engineered human cystathionine gamma lyase (e59n, r119l, e339v) to depleting methionine (see paper)
32% identity, 75% coverage: 48:340/392 of query aligns to 44:334/386 of 5tsuC
- active site: R48 (≠ L52), Y100 (= Y105), D173 (= D177), K198 (= K202)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-methionine: G76 (= G80), L77 (= L81), Y100 (= Y105), E143 (= E148), N147 (≠ S152), D173 (= D177), S195 (≠ A199), T197 (= T201), K198 (= K202), S326 (= S332)
Sites not aligning to the query:
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
33% identity, 87% coverage: 48:389/392 of query aligns to 43:383/384 of 4iyoD
- active site: R47 (≠ L52), Y99 (= Y105), D172 (= D177), K197 (= K202)
- binding serine: Y45 (= Y50), T48 (≠ H53), Y99 (= Y105), Y99 (= Y105), R104 (≠ E110), K197 (= K202), N227 (≠ M231), E325 (≠ W331), S326 (= S332), T341 (= T347), R361 (= R367)
Query Sequence
>RR42_RS07655 FitnessBrowser__Cup4G11:RR42_RS07655
MATVAVQPELDIAPGFASFSQATHRGSTVVFRNLAELRAHGDGATTYWRYGLHATPTSEA
LCQHLALIEGARHALLLPSGLAAISQVYFALVKSGDDVLVPDNVYGPNREHGEWLARDFG
VSVRYYDPMIGAGIAGLIRSNTRLIWMESPGSVTMEIPDTEAIVAAAKARGVLTAIDNTW
SAGVYFRPFDKGIDISVQALTKYQSGGSDVLMGAVLSTDDKLHDRIKRARMLMGWGVSAD
DCYLVLRSLPSMPVRLAAHDRAAREVAEWLTQRPEVVKVLHPALPDCPGHDFWRRDFSGA
TGLFSIVLHARYTRAQVDAFVEALRLFAIGWSWGGAHSLALPYHVQTMRPQGSWPPVGWE
NTGELVRLYIGLEDTRDLIADLRGAMESQLVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory